[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07053.1
DDBJ      :             Phenylacetic acid degradation-related protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->139 3dkzA PDBj 6e-31 56.3 %
:RPS:PDB   21->138 3dkzB PDBj 3e-22 43.0 %
:RPS:SCOP  22->138 1zkiA1  d.38.1.5 * 3e-25 26.7 %
:HMM:SCOP  13->138 1zkiA1 d.38.1.5 * 1.3e-31 34.4 %
:RPS:PFM   54->125 PF03061 * 4HBT 2e-04 36.1 %
:HMM:PFM   54->129 PF03061 * 4HBT 8.8e-17 39.5 76/79  
:BLT:SWISS 20->139 Y1336_HALSA 2e-11 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07053.1 GT:GENE ABF07053.1 GT:PRODUCT Phenylacetic acid degradation-related protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 175607..176041 GB:FROM 175607 GB:TO 176041 GB:DIRECTION + GB:PRODUCT Phenylacetic acid degradation-related protein GB:PROTEIN_ID ABF07053.1 GB:DB_XREF GI:93352964 InterPro:IPR003736 InterPro:IPR006683 LENGTH 144 SQ:AASEQ MNEIIPAAPGTPDKPYFGIDIPLMRLLGLQPVHMEEGLCRTRLPANPNVVNSRGDVHGGTLMAVLDFTLSGAARSHAPLETGVITIDMSTHFLSAARGELTFEARIMRRGAKIAFCEGEARDATGTLCCVARASFKLVKLVGGD GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 20->139|Y1336_HALSA|2e-11|33.3|120/151| BL:PDB:NREP 1 BL:PDB:REP 16->139|3dkzA|6e-31|56.3|119/121| RP:PDB:NREP 1 RP:PDB:REP 21->138|3dkzB|3e-22|43.0|114/120| RP:PFM:NREP 1 RP:PFM:REP 54->125|PF03061|2e-04|36.1|72/79|4HBT| HM:PFM:NREP 1 HM:PFM:REP 54->129|PF03061|8.8e-17|39.5|76/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 22->138|1zkiA1|3e-25|26.7|116/126|d.38.1.5| HM:SCP:REP 13->138|1zkiA1|1.3e-31|34.4|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 82 OP:NHOMOORG 64 OP:PATTERN ---------------------1---11----------------1------------------------ ---------------------------------------------------------------------------------------------1-------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------------------------1--2-2----------------------------------------------------------------------------------1111111111111111111111111111122221211111134322131-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 99.3 SQ:SECSTR ccccccHHHHHHHHTTccccccHHHHTTcEEEEEcccEEEEEEcccGGGccTTccccHHHHHHHHHHHHHTTTTTcTcTTETccEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEcTTccEEEEEEEEEEEccEEcc# DISOP:02AL 1-1,143-145| PSIPRED ccccccccccccccccccccccHHHHcccEEEEEEccEEEEEEEccHHHcccccEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEEEccccc //