[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07057.1
DDBJ      :             membrane protein of unknown function
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->106 PF04020 * DUF360 4e-08 46.2 %
:HMM:PFM   1->106 PF04020 * DUF360 3.8e-33 52.8 106/108  
:BLT:SWISS 8->110 Y3922_STRCO 2e-10 36.9 %
:TM
:REPEAT 2|4->42|64->102
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07057.1 GT:GENE ABF07057.1 GT:PRODUCT membrane protein of unknown function GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 179182..179529 GB:FROM 179182 GB:TO 179529 GB:DIRECTION + GB:PRODUCT membrane protein of unknown function GB:PROTEIN_ID ABF07057.1 GB:DB_XREF GI:93352968 InterPro:IPR007165 LENGTH 115 SQ:AASEQ MRLLAVWIINAAALFLVGYLISGVHLGSFGSAMIAALVLGLVNALIRPILVILTLPVTLLTLGLFIFVINALLFLFVGNLLQGFVVDGFGPALLGSILYSVIAWILASVLLGERN GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 8->110|Y3922_STRCO|2e-10|36.9|103/100| TM:NTM 4 TM:REGION 3->25| TM:REGION 31->53| TM:REGION 62->84| TM:REGION 91->112| NREPEAT 1 REPEAT 2|4->42|64->102| SEG 48->62|pilviltlpvtlltl| RP:PFM:NREP 1 RP:PFM:REP 1->106|PF04020|4e-08|46.2|106/106|DUF360| HM:PFM:NREP 1 HM:PFM:REP 1->106|PF04020|3.8e-33|52.8|106/108|DUF360| OP:NHOMO 69 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- -11------------------------------------------------------------------------------------------------1-1-----1-------------------1-1----1--------------122-----------11------------------------------------------------------------------1--------------------------------------------------------------------------------------------11---------------------------------1-------------------1----------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111----1-11111--1-111---12--------------1----------------1--1-1-1------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 114-116| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //