[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07066.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:RPS:PFM   1->60 PF11146 * DUF2905 2e-06 45.0 %
:HMM:PFM   1->63 PF11146 * DUF2905 1.8e-23 38.1 63/64  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07066.1 GT:GENE ABF07066.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(187618..187812) GB:FROM 187618 GB:TO 187812 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID ABF07066.1 GB:DB_XREF GI:93352977 LENGTH 64 SQ:AASEQ MLRWTFTIFLCVIVLSASLPWLQKIGLGRLPGDVRFRLFGREYVLPFASTILLSLAALVIGKLL GT:EXON 1|1-64:0| TM:NTM 2 TM:REGION 1->23| TM:REGION 43->64| RP:PFM:NREP 1 RP:PFM:REP 1->60|PF11146|2e-06|45.0|60/64|DUF2905| HM:PFM:NREP 1 HM:PFM:REP 1->63|PF11146|1.8e-23|38.1|63/64|DUF2905| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111-----111--111-1-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccEEEEHHHHHHHHHHHHHHHHHHHc //