[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07075.1
DDBJ      :             type-4 fimbrial biogenesis pilV transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:180 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  14->135 1oqwA_ d.24.1.1 * 0.00042 15.3 %
:HMM:PFM   13->25 PF07963 * N_methyl 3.8e-05 53.8 13/20  
:PROS 12->32|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07075.1 GT:GENE ABF07075.1 GT:PRODUCT type-4 fimbrial biogenesis pilV transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 196825..197367 GB:FROM 196825 GB:TO 197367 GB:DIRECTION + GB:PRODUCT type-4 fimbrial biogenesis pilV transmembrane protein GB:PROTEIN_ID ABF07075.1 GB:DB_XREF GI:93352986 InterPro:IPR001120 LENGTH 180 SQ:AASEQ MQLKTTGNRHAAGFSLLEVLIALVITVIGLFGIAKMQAAAIANTQVARGQSLIALQLESLAGAMHGNKGFWAAGLVPATFSMTGATVTDTTGKLSTTAPDCKATTCTPTQLAAYDVQGWAAEMNAHFPTYSAAVNCVVLINKPVTCTVSANWNESNLAYNQTTATLAGQTAQSLTLYVQP GT:EXON 1|1-180:0| PROS 12->32|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 14->36| SEG 161->176|qttatlagqtaqsltl| HM:PFM:NREP 1 HM:PFM:REP 13->25|PF07963|3.8e-05|53.8|13/20|N_methyl| HM:SCP:REP 14->135|1oqwA_|0.00042|15.3|118/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEEccccccccccHHHHccccccEEEEEEcc //