[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07079.1
DDBJ      :             pilus assembly protein PilE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:147 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  11->148 1oqwA_ d.24.1.1 * 1.1e-27 26.8 %
:HMM:PFM   39->130 PF02771 * Acyl-CoA_dh_N 0.00019 19.3 88/113  
:HMM:PFM   10->28 PF07963 * N_methyl 0.0002 47.4 19/20  
:PROS 9->29|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07079.1 GT:GENE ABF07079.1 GT:PRODUCT pilus assembly protein PilE GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 202083..202526 GB:FROM 202083 GB:TO 202526 GB:DIRECTION + GB:PRODUCT pilus assembly protein PilE GB:PROTEIN_ID ABF07079.1 GB:DB_XREF GI:93352990 InterPro:IPR001082 InterPro:IPR001120 InterPro:IPR012902 LENGTH 147 SQ:AASEQ MNRRPKHSAGFSLVELMIVAIIVAILAAIAFPSYMQHVRKSRRTDAKTALLDAAARQEKVFSTQNLYGGAPGDLGYAGAAYPVQIQSSGQTFYQLTVATANSGTTYTATAAPVGAQAGDDCGSYVINNLGVQSNTGTSNGATSATCW GT:EXON 1|1-147:0| PROS 9->29|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 11->33| SEG 18->30|ivaiivailaaia| SEG 43->56|rtdaktalldaaar| HM:PFM:NREP 2 HM:PFM:REP 39->130|PF02771|0.00019|19.3|88/113|Acyl-CoA_dh_N| HM:PFM:REP 10->28|PF07963|0.0002|47.4|19/20|N_methyl| HM:SCP:REP 11->148|1oqwA_|1.1e-27|26.8|138/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--2----1----11------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1--------11-------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,134-144| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccccccEEEEEEEEEccccEEEEEEEEccccccccccEEEEccccccccccccccccccccc //