[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07093.1
DDBJ      :             amino acid permease-associated region
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  552/915 : Eukaryota  128/199 : Viruses  0/175   --->[See Alignment]
:469 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->340 3gi9C PDBj 1e-19 23.7 %
:RPS:PFM   31->399 PF00324 * AA_permease 2e-31 34.7 %
:HMM:PFM   29->441 PF00324 * AA_permease 6.6e-42 21.6 394/479  
:BLT:SWISS 2->461 YHDG_BACSU e-140 57.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07093.1 GT:GENE ABF07093.1 GT:PRODUCT amino acid permease-associated region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 217473..218882 GB:FROM 217473 GB:TO 218882 GB:DIRECTION + GB:PRODUCT amino acid permease-associated region GB:PROTEIN_ID ABF07093.1 GB:DB_XREF GI:93353004 InterPro:IPR002293 InterPro:IPR004841 LENGTH 469 SQ:AASEQ MSLFRTKNIDAMLEVSEHDGLRKVLGAVDLVLMGIGAIIGTGIFVLTGTGALTAGPALTVSFVIAAMACGFAALCYAEFASAIPVSGSIYTYSYATLGEIVAWMIGWDLLLEYGLATSAVSVGWSGYFQSLIAGFGIHLPTVLTAAPGAVPGEHTLFNLPACLIMLAITWIVSYGVKESARLNNVMVAIKIGVVLLFIAVGVWHVKPANWQPFAPFGMTGVFNAAALVFFAFIGFDAVTSAAEEVRNPRRDLPIGIIGSLAVCTILYVTVAAIMTGIVPFMKFEGVDHPVSLALQYAGQNWVAGFVDLGAILGMTTVILVMTYGQTRIIFAMSRDGLLPEALSTVHPVHATPYTATWTVGIVFAAIAAFVPLNVLAELINIGTLAAFTLISIAILVLRRTRPDLRRGFRCPGVPVVPLLAVGFCLFLMAHLQALTWIAFLCWIGLGLIIYFAYSRRNAVLHNHGGDAEG GT:EXON 1|1-469:0| BL:SWS:NREP 1 BL:SWS:REP 2->461|YHDG_BACSU|e-140|57.0|460/465| TM:NTM 13 TM:REGION 24->46| TM:REGION 60->82| TM:REGION 98->120| TM:REGION 129->151| TM:REGION 156->178| TM:REGION 183->205| TM:REGION 217->239| TM:REGION 259->281| TM:REGION 302->324| TM:REGION 356->377| TM:REGION 383->397| TM:REGION 408->430| TM:REGION 433->454| SEG 221->232|vfnaaalvffaf| SEG 361->370|ivfaaiaafv| SEG 411->422|pgvpvvpllavg| BL:PDB:NREP 1 BL:PDB:REP 23->340|3gi9C|1e-19|23.7|299/437| RP:PFM:NREP 1 RP:PFM:REP 31->399|PF00324|2e-31|34.7|352/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 29->441|PF00324|6.6e-42|21.6|394/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 2499 OP:NHOMOORG 717 OP:PATTERN ---1--1-11111--124--1--133334123--1-1------31-12-2233----1-1-2441--1 6682422211111262243-441176444442487836HD----2121122-9384-6--1-2134E845121112331-115-111111-111-----2-321152453--------------1-1111--21-1------------------------------1-----------------------182755555666536577722225A454421-13122222222-111111111111111112423613413224666622353233111---21111111111111111111111111111111121112221-11411212222-1--222-211-1----2-11--12--11-6--51---4-22222-----34--2---12---------------33134252-1-------111--1111121---------13333333323333-------------111111111111111-----11323111-18BB7B9565647743777746A822333-1333-1---31-1-1----11242-------111---1-------11-11-1-------11-----1-------------------------32112211------112222---1111--1-1-2---1---------33244315553533354-55554335355335555535541413-313233333332322344422234--322222122222----2222222221--21--------------14444435111-157773653-776712223121121111--------------34776776683333----1111----------1----------------------------1--------1-1 ----32----1-9711---1---1-1-11----2111----11---12-11---111111-1411----1--1-------1-1-2--1---------------332--1-BKOAHHG5446695GD796EU9199E3563O57KA46456N84C5AADAAQk37B64F9AR56A3222-71114469AI-9613A7A9- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 69.5 SQ:SECSTR ######################ccccHHHHHHHHHHHHHHHHTTTTHHHHHHHTGGGHHHHHHHHHHHHHHHHHHHHHHTTTcccTTTHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccccHcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHccccHHHHHHHHHHHHHTTGGGTHHHHHHTTGGGcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHTcTTHHHHHTHHHHcHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHcccccGGcccccc######################################################################################################################### DISOP:02AL 1-1,8-25,458-470| PSIPRED ccccccccccHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccc //