[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07097.1
DDBJ      :             histidine triad (HIT) protein
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  462/915 : Eukaryota  83/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->111 3imiC PDBj 1e-19 39.4 %
:RPS:SCOP  8->141 1y23A  d.13.1.1 * 1e-26 32.1 %
:HMM:SCOP  3->140 1emsA1 d.13.1.1 * 5e-42 42.8 %
:RPS:PFM   19->110 PF01230 * HIT 4e-18 41.3 %
:HMM:PFM   16->111 PF01230 * HIT 1.1e-27 37.5 96/98  
:BLT:SWISS 8->111 HIT_BACSU 1e-18 38.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07097.1 GT:GENE ABF07097.1 GT:PRODUCT histidine triad (HIT) protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 224403..224840 GB:FROM 224403 GB:TO 224840 GB:DIRECTION + GB:PRODUCT histidine triad (HIT) protein GB:PROTEIN_ID ABF07097.1 GB:DB_XREF GI:93353008 InterPro:IPR001310 LENGTH 145 SQ:AASEQ MQAEYDSNNIFARILRGELPCFKVYEDADTIAFMDIMPQSDGHTLVVPKEQAVDVFGLSEAGAAAAIRATQIVARGVREAFQPDGVVISQFNGAAAGQTVPHIHFHIVPRYVDQPLRGHARQQQDMGVLKQHAERVIAALAKLKG GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 8->111|HIT_BACSU|1e-18|38.5|104/145| SEG 61->75|agaaaairatqivar| BL:PDB:NREP 1 BL:PDB:REP 8->111|3imiC|1e-19|39.4|104/140| RP:PFM:NREP 1 RP:PFM:REP 19->110|PF01230|4e-18|41.3|92/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 16->111|PF01230|1.1e-27|37.5|96/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 8->141|1y23A|1e-26|32.1|134/139|d.13.1.1| HM:SCP:REP 3->140|1emsA1|5e-42|42.8|138/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 652 OP:NHOMOORG 588 OP:PATTERN ---1----11111112111-111-111-1-11---11111111-----11111--11--1-122-211 --1-1--1------32211-12112112222222222322--11-1-----1--------11-1--1----1---111----------1111-1111--1111-1111-1--------------------------11111---11-1--11-1---11111------1-1-------1--1----------112222211112121112111112211111111111111--11111111111111111111111122111111111111-211111111111111111111111111111111111111111111111111--1111111111111--11111111-1-111--------1---11-----1-1211111111111112111121211111111111-111111111111111111111111111111--111111111111111-1111111111111111111-------------1111111111-11111111111111111111111-11111111---111--1111-11---11------------1--212---111---111111-1-111111-1--1--1-----------1-1111111-1---11----11--------------------------1------------------------------------------------------------------------------------------------------------1-----------------11111111111-2222-1--1----1-----------------------------------------1---------11111111--11111----11--1---1111--------1--------- --------2111---1111--------11-1---1111111111-1----1111111-11-1-11111-111111-1----1111111-322112211-1111-11--2--11-1----------------------------------------------------------1-1--17-----11121-1--111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 71.7 SQ:SECSTR #######ccHHHHHHTTcccccEEEEcccEEEEEcTTcccTTcEEEEEccccccGGGccHHHHHHHHHTHHHHHHHHHHHHcccEEEEEccccGGGTcccccccEEEEEEc################################## DISOP:02AL 1-4,145-146| PSIPRED cccccccccEEEEEEcccccccEEEEccEEEEEEcccccccEEEEEEEccccccHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHcccEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHcc //