[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07107.1
DDBJ      :             protein of unknown function DUF454
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   63->132 PF04304 * DUF454 6e-09 40.6 %
:HMM:PFM   63->133 PF04304 * DUF454 2.4e-27 39.4 71/71  
:HMM:PFM   17->66 PF10003 * DUF2244 0.0004 24.0 50/140  
:BLT:SWISS 52->134 YBAN_SHIFL 4e-10 36.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07107.1 GT:GENE ABF07107.1 GT:PRODUCT protein of unknown function DUF454 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(235367..235819) GB:FROM 235367 GB:TO 235819 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF454 GB:PROTEIN_ID ABF07107.1 GB:DB_XREF GI:93353018 InterPro:IPR007401 LENGTH 150 SQ:AASEQ MQPDDPERQTTLTHRERAIRAFWVTCGTLSLALGVIGIFLPVLPTTPFVLLAAACFARGSERFHRWLLAHHRFGPLVHDWQTHRSIPFRAKCLALSMMWPSMIITAWLMRERPVASITLIAIALGTTVWMVRLPTRPRGGHVRSSNAQPE GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 52->134|YBAN_SHIFL|4e-10|36.6|82/125| TM:NTM 3 TM:REGION 28->50| TM:REGION 91->110| TM:REGION 113->134| SEG 39->51|flpvlpttpfvll| RP:PFM:NREP 1 RP:PFM:REP 63->132|PF04304|6e-09|40.6|69/70|DUF454| HM:PFM:NREP 2 HM:PFM:REP 63->133|PF04304|2.4e-27|39.4|71/71|DUF454| HM:PFM:REP 17->66|PF10003|0.0004|24.0|50/140|DUF2244| OP:NHOMO 89 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- ------1-11-----------------------------------------------------------------------------------1----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------------------------------------------1--2-1-------------------------------------------------------11------------------------------1111-----11------1--11-1----1111111111----1--------------1-1--1---1111---------------------------------1---1---------------------------1----------1----------------------------------111------------------------------------------------------------1---------------1-1--111111-11111-11111111-11-------------1-----1----1111111-11----------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-9,134-151| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //