[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07112.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  265/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->201 2fukA PDBj 2e-32 44.0 %
:RPS:PDB   8->203 3c8hB PDBj 2e-08 9.7 %
:RPS:SCOP  1->214 2fukA1  c.69.1.36 * 1e-11 33.7 %
:HMM:SCOP  3->214 1dinA_ c.69.1.9 * 1.1e-23 26.9 %
:RPS:PFM   62->197 PF00326 * Peptidase_S9 2e-08 36.4 %
:HMM:PFM   48->149 PF02129 * Peptidase_S15 1.7e-12 31.9 91/272  
:HMM:PFM   153->181 PF00326 * Peptidase_S9 0.00012 34.5 29/213  
:BLT:SWISS 10->200 Y471_RICPR 4e-20 36.3 %
:REPEAT 2|51->100|134->183

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07112.1 GT:GENE ABF07112.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(240002..240646) GB:FROM 240002 GB:TO 240646 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF07112.1 GB:DB_XREF GI:93353023 InterPro:IPR000379 LENGTH 214 SQ:AASEQ MNAHTQVTTFAGPVGAIDISIDLPQNAPVRGLALVAHPHPLFAGTKDNKVAQTLARTFVALGYATVRPNFRGVGGTAGEHDKGIGEQDDLLAVIDWMRTQTAWSPDVATLPLALGGFSFGSFVQTHVARRLAEAGTPAQRLVVVGTATSRWDVANVPADTIVIHGEQDDTVPLASVFDWARPQDLPVIVIPGADHFFHRKLHLIKQLVVNAWDR GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 10->200|Y471_RICPR|4e-20|36.3|182/238| NREPEAT 1 REPEAT 2|51->100|134->183| BL:PDB:NREP 1 BL:PDB:REP 9->201|2fukA|2e-32|44.0|182/218| RP:PDB:NREP 1 RP:PDB:REP 8->203|3c8hB|2e-08|9.7|195/376| RP:PFM:NREP 1 RP:PFM:REP 62->197|PF00326|2e-08|36.4|132/208|Peptidase_S9| HM:PFM:NREP 2 HM:PFM:REP 48->149|PF02129|1.7e-12|31.9|91/272|Peptidase_S15| HM:PFM:REP 153->181|PF00326|0.00012|34.5|29/213|Peptidase_S9| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF00326|IPR001375| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF00326|IPR001375| RP:SCP:NREP 1 RP:SCP:REP 1->214|2fukA1|1e-11|33.7|205/218|c.69.1.36| HM:SCP:REP 3->214|1dinA_|1.1e-23|26.9|197/233|c.69.1.9|1/1|alpha/beta-Hydrolases| OP:NHOMO 277 OP:NHOMOORG 270 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111122221111111111111-111111---111111111111111-1-1--------------------11-1--11-------------------------11---------------------------------------------------------------------------------------------------------------------------------1111111111-1------------------111111111111111111111222111111111111111--------------11111111111111----------------------------------------------------------- ------------11------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 98.6 SQ:SECSTR ###TcccEEEEETTTTEEEEEEEEEcccccccEEEEEcHHHHHHTccHHHHHHHHHTTcccccEEEEEccccHHHHHHHTTTcHHHHHHHHHTHHHHHHHHHccccccGGGcEEEEETHHHHHHHHHHHHTTTTcTTcccccHHHHHHHTTccccTTcEEEEEEEcccHHHHHHHHHHHTGGGGGGEEEEcccccHHHHHHHHHHHHccTTcEH DISOP:02AL 1-3| PSIPRED cccEEEEEEEEcccccEEEEEEccccccccEEEEEEcccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHcc //