[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07120.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->164 2dlxA PDBj 6e-07 13.4 %
:RPS:SCOP  35->128 1a8yA1  c.47.1.3 * 2e-06 8.9 %
:HMM:SCOP  26->151 1senA_ c.47.1.1 * 1.1e-08 17.0 %
:RPS:PFM   39->126 PF02435 * Glyco_hydro_68 2e-04 33.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07120.1 GT:GENE ABF07120.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(251042..251539) GB:FROM 251042 GB:TO 251539 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07120.1 GB:DB_XREF GI:93353031 LENGTH 165 SQ:AASEQ MTPRSPLLRTVLHGLAALLLLVGPAVSMAASHLPPVTDIAAQSADAAKQGGPLVVLVSLPGCTYCETARRNYLAPQAAAGEITARELDMTADTPLRDADGTMTTAKQWARAHNITVAPTVLFLDRNGRNLASPLRGLQPDFYGAYLEQAVDTARAKLTEGLAASK GT:EXON 1|1-165:0| TM:NTM 1 TM:REGION 8->30| SEG 7->26|llrtvlhglaallllvgpav| RP:PDB:NREP 1 RP:PDB:REP 28->164|2dlxA|6e-07|13.4|127/153| RP:PFM:NREP 1 RP:PFM:REP 39->126|PF02435|2e-04|33.8|74/421|Glyco_hydro_68| GO:PFM:NREP 2 GO:PFM GO:0007587|"GO:sugar utilization"|PF02435|IPR003469| GO:PFM GO:0050053|"GO:levansucrase activity"|PF02435|IPR003469| RP:SCP:NREP 1 RP:SCP:REP 35->128|1a8yA1|2e-06|8.9|90/124|c.47.1.3| HM:SCP:REP 26->151|1senA_|1.1e-08|17.0|112/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------1---11-1-----------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 83.0 SQ:SECSTR ###########################cccTTcccTTTcccccHHHHHHTcEEEEEEEcccTTTHHHHHHHTHHHHHHHHTTcHHHHHHHHTEEEEEEEcccHHHHHHHHHHTcccccEEEEEcTTTccccEEEccccHHHHHHHHHHHHHHTccccccccccc# DISOP:02AL 1-4,162-166| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcccHHHcccEEEEEEEEccccEEEEcccccccHHHHHHHcccEEccEEEEEcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccc //