[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07125.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   101->156 1zr6A PDBj 7e-04 30.4 %
:RPS:PFM   47->240 PF09694 * Gcw_chp 2e-41 55.7 %
:HMM:PFM   39->266 PF09694 * Gcw_chp 1e-79 49.8 219/226  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07125.1 GT:GENE ABF07125.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 255651..256451 GB:FROM 255651 GB:TO 256451 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07125.1 GB:DB_XREF GI:93353036 InterPro:IPR010239 LENGTH 266 SQ:AASEQ MKKSSLAVSAAAALFSLATSVAFAQSAPEAAAPAAAPAAEPASPHTITANVSLVSDYRYRGLSQTNRRPAIQGGFDYAHESGFYIGNWNSTISWISDADKSVSAPVEMDFYGGFKNTFKMSDLEFNYDVGVLQYFYPGGYSNPRPYTTELYAGIGYGPVFLKYSQAVTNLFGIANSQYSSYIDLAFNYPLNVWDLTLNAHLGYQNVQHNSAASYLDWKVGLTKDLGKGFALAVAYIGTNAKESFYTNSYNHNVGNNTAWVSLSKTF GT:EXON 1|1-266:0| SEG 4->24|sslavsaaaalfslatsvafa| SEG 26->44|sapeaaapaaapaaepasp| BL:PDB:NREP 1 BL:PDB:REP 101->156|1zr6A|7e-04|30.4|56/479| RP:PFM:NREP 1 RP:PFM:REP 47->240|PF09694|2e-41|55.7|183/209|Gcw_chp| HM:PFM:NREP 1 HM:PFM:REP 39->266|PF09694|1e-79|49.8|219/226|Gcw_chp| OP:NHOMO 182 OP:NHOMOORG 99 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------------------------------1-------------11111------------------------1-------------------------------1231111111------------------------333212222--1112-1-112211223------------212----------------------------------------------------1---------2--7-12-3444414433333344346-----11--------------------------------------------------------------------------------------------------------------------------2212211---1-1111-11-------------------1--------------1111111111-----1--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 21.1 SQ:SECSTR ####################################################################################################EEEEEEEEcHHHHHTTccTTccccccccccccccEEEEEEEEccccHHHHHHHHHH############################################################################################################## DISOP:02AL 1-8,31-36| PSIPRED cccccEEEHHHHHHHHHHHHHEEcccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEcccEEEEEEcccccccccccccccccEEEEEEEEEEcEEccccccEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEEEEEEEEcccccccccccccEEEEEEEccccccccEEEEEEEEEEEcccccccccEEEEEEEEEcccccEEEEEEEEEcccccccccccccccccccEEEEEEEEEc //