[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07138.1
DDBJ      :             Glutaredoxin, GrxC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  270/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->83 1fovA PDBj 2e-15 44.4 %
:RPS:PDB   3->83 3d5jB PDBj 1e-11 24.7 %
:RPS:SCOP  3->73 1h75A  c.47.1.1 * 7e-10 24.6 %
:HMM:SCOP  1->84 1wikA_ c.47.1.1 * 2.1e-21 39.8 %
:RPS:PFM   4->64 PF00462 * Glutaredoxin 2e-07 36.7 %
:HMM:PFM   4->64 PF00462 * Glutaredoxin 2e-22 46.7 60/60  
:BLT:SWISS 1->83 GLRX_NEIMB 6e-16 47.0 %
:PROS 6->22|PS00195|GLUTAREDOXIN_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07138.1 GT:GENE ABF07138.1 GT:PRODUCT Glutaredoxin, GrxC GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 269216..269473 GB:FROM 269216 GB:TO 269473 GB:DIRECTION + GB:PRODUCT Glutaredoxin, GrxC GB:PROTEIN_ID ABF07138.1 GB:DB_XREF GI:93353049 InterPro:IPR002109 InterPro:IPR011767 InterPro:IPR011900 LENGTH 85 SQ:AASEQ MARVVMYSTVVCPYCQMAERLLKQRGVEAIEKILIDREPGKREEMMTRTGRRTVPQIYIDETHVGGFDDLSALDRQGGLVPLLAA GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 1->83|GLRX_NEIMB|6e-16|47.0|83/85| PROS 6->22|PS00195|GLUTAREDOXIN_1|PDOC00173| SEG 42->53|reemmtrtgrrt| BL:PDB:NREP 1 BL:PDB:REP 2->83|1fovA|2e-15|44.4|81/82| RP:PDB:NREP 1 RP:PDB:REP 3->83|3d5jB|1e-11|24.7|81/107| RP:PFM:NREP 1 RP:PFM:REP 4->64|PF00462|2e-07|36.7|60/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 4->64|PF00462|2e-22|46.7|60/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 3->73|1h75A|7e-10|24.6|69/76|c.47.1.1| HM:SCP:REP 1->84|1wikA_|2.1e-21|39.8|83/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 277 OP:NHOMOORG 271 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1-11--11-1111111--1111121-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----1------------------------11111111--1-1--11111111-11-1-1111111111--------111--11-------------------------------11111111111111111111111121111111111111111111111111111111111111111111111111111-----------------------11-111---------------------------11---1-1--1------------------------1--2------11--1111111111-11-1111111111111111111111-----1111111111111111111111111-111111111111---1---------111-1---------------11111111111111111111121221111------------------------11111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 100.0 SQ:SECSTR cccEEEEEcTTcHHHHHHHHHHHTTcccEEEGGGcTTHHHHHHHHHHHHccccccEEEETTEEEEcHHHHHHHHHHcHHHHHHTH DISOP:02AL 85-86| PSIPRED ccEEEEEEccccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHccccccEEEEccEEEccHHHHHHHHHcccHHHHHcc //