[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07142.1
DDBJ      :             Uncharacterized protein UPF0065
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  193/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.288.1c.94.1e.26.1
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->324 2qpqA PDBj 3e-59 38.8 %
:RPS:PDB   29->326 2dvzA PDBj 5e-68 34.4 %
:RPS:SCOP  28->86 1jqkA  e.26.1.2 * 1e-15 18.6 %
:RPS:SCOP  235->326 2o70A1  a.288.1.1 * 2e-20 10.9 %
:HMM:SCOP  116->293 1hslA_ c.94.1.1 * 3.4e-10 24.3 %
:RPS:PFM   49->321 PF03401 * Bug 2e-55 48.9 %
:HMM:PFM   49->322 PF03401 * Bug 1.6e-90 45.8 273/274  
:HMM:PFM   2->24 PF10518 * TAT_signal 1.6e-05 39.1 23/26  
:BLT:SWISS 27->318 YTCB_PSESQ 2e-57 40.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07142.1 GT:GENE ABF07142.1 GT:PRODUCT Uncharacterized protein UPF0065 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 274268..275251 GB:FROM 274268 GB:TO 275251 GB:DIRECTION + GB:PRODUCT Uncharacterized protein UPF0065 GB:PROTEIN_ID ABF07142.1 GB:DB_XREF GI:93353053 InterPro:IPR005064 LENGTH 327 SQ:AASEQ MPSRRHTLKALIATFAAGAVPAVAHADTWPAKPIRMIVPFPPGSSPDLIARIVTEKLATVLGQPVVVENRPGAGGNIGTGMVAKAAPDGYTLLFTINGPLVTAPSLYRHLSYDPMKQLAPVTLVATSPNVLVIDARLPVHTLREFVALAKSKPGALNYGSVGNGSAAHLAMEQLKAMAGIDLQHVPYPGFPQITTAIVGGQVQAGFMVPAIAMPMVNAGKLRILAVTTTGRTSLLPSVPTVAESGYPGFEAISWQAILAPAGTPAPVVDRLYRELVRIIGSDDIREKMRTQYFVPAGTAPASLRETMVSEKARWDKVIRAAGVQPEG GT:EXON 1|1-327:0| BL:SWS:NREP 1 BL:SWS:REP 27->318|YTCB_PSESQ|2e-57|40.8|289/336| SEG 13->26|atfaagavpavaha| BL:PDB:NREP 1 BL:PDB:REP 30->324|2qpqA|3e-59|38.8|294/296| RP:PDB:NREP 1 RP:PDB:REP 29->326|2dvzA|5e-68|34.4|291/292| RP:PFM:NREP 1 RP:PFM:REP 49->321|PF03401|2e-55|48.9|272/274|Bug| HM:PFM:NREP 2 HM:PFM:REP 49->322|PF03401|1.6e-90|45.8|273/274|Bug| HM:PFM:REP 2->24|PF10518|1.6e-05|39.1|23/26|TAT_signal| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03401|IPR005064| RP:SCP:NREP 2 RP:SCP:REP 28->86|1jqkA|1e-15|18.6|59/610|e.26.1.2| RP:SCP:REP 235->326|2o70A1|2e-20|10.9|92/165|a.288.1.1| HM:SCP:REP 116->293|1hslA_|3.4e-10|24.3|152/238|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2292 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- --------111----------1---1-------111---1----1--------32-1-------212-111-----------------------------------------------------------------111--------------------------------------------41---11---11111111--1111114122-1111--113--------3--------------------------------------------------------------------------------------------5---------------------1----1----44-----1-------1---------------Y67--874986----------4-21111---F---14423376336562---6353-353-2--------------1------------------------------------R****-------------1---------D****9G322K7tkj*e*3**5A1-----------------1----12-1-1----1----------1111-------------------------------------------1111----11----------------------1-1------1-111-------111-1--1-11-113-------1-----------------------------------------------------165---1-2--------1--------1-4-111111--111111111--------------11111----1--1--------------1------------------------------------------------4------ -------------1------------------------------------------------------------------------------------------------------------------------------------------------L--------------1-----------1--v---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 91.7 SQ:SECSTR ##########################cTcccccEEEEEcccTTcHHHHHHHHHHHHHHHHHTTccEEEEcccGGGHHHHHHHHHccTTccEEEEEcHHHHHHHHHcTTTccccTTTcEEEEEEEEEEcEEEEEcTTcccccHHHHHHHHHTcTTTcEEEEccTTcHHHHHHHHHHccHTcccEEEEcccHHHHHHHHHHTcccEEEEEHHcHHHHHHTTccEHEEEEcccccGGGTTcccTTTTTcGGGcccEEEEEEEETTcccHHHHHHHHHHHHHHTcHHHHHHHHHHTEEEccccHHHHHHHHHHHHHHHHHHHHcTTcccc# DISOP:02AL 1-1,326-328| PSIPRED cccHHHHHHHHHHHHHcccccHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEEEcccccccccccccHHHcccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHccccccc //