[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07152.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->60 PF11137 * DUF2909 6e-10 51.7 %
:HMM:PFM   1->61 PF11137 * DUF2909 1.6e-27 42.6 61/63  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07152.1 GT:GENE ABF07152.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(283456..283665) GB:FROM 283456 GB:TO 283665 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF07152.1 GB:DB_XREF GI:93353063 LENGTH 69 SQ:AASEQ MRFVILVAFILIIGSLASALFFMMRDRGRTPNMMRSLMFRVGFSVALFLFILFSHWMGWIQSTGIHTSP GT:EXON 1|1-69:0| TM:NTM 2 TM:REGION 3->24| TM:REGION 35->57| RP:PFM:NREP 1 RP:PFM:REP 1->60|PF11137|6e-10|51.7|60/62|DUF2909| HM:PFM:NREP 1 HM:PFM:REP 1->61|PF11137|1.6e-27|42.6|61/63|DUF2909| OP:NHOMO 45 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-212221-11111-11111111221111111111------1--1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 66-70| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //