[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07160.1
DDBJ      :             glycosyl transferase, family 3
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  244/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.46.2c.27.1
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->208 1o17B PDBj 5e-09 28.3 %
:RPS:PDB   15->298 2bpqA PDBj 8e-33 18.5 %
:RPS:SCOP  15->81 1azyA1  a.46.2.1 * 7e-14 17.9 %
:RPS:SCOP  103->298 1kgzA2  c.27.1.1 * 3e-21 16.2 %
:HMM:SCOP  14->82 1khdA1 a.46.2.1 * 2e-14 43.5 %
:HMM:SCOP  86->323 1o17A2 c.27.1.1 * 5.4e-34 28.3 %
:RPS:PFM   17->76 PF02885 * Glycos_trans_3N 1e-08 43.3 %
:HMM:PFM   13->77 PF02885 * Glycos_trans_3N 1.3e-16 39.3 61/66  
:BLT:SWISS 13->298 YBIB_ECOLI 2e-54 43.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07160.1 GT:GENE ABF07160.1 GT:PRODUCT glycosyl transferase, family 3 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(290128..291117) GB:FROM 290128 GB:TO 291117 GB:DIRECTION - GB:PRODUCT glycosyl transferase, family 3 GB:PROTEIN_ID ABF07160.1 GB:DB_XREF GI:93353071 InterPro:IPR000312 LENGTH 329 SQ:AASEQ MTSASRAPFPAAKYIKEIGRGVNGARALPREDAQALFDAMLAGRVSDLELGAVLLAYRIKGEAPHELAGMLDAAHDHCAPLAAPADKPVVVIPSYNGARKQPNLVPLLAMLLARDGVPTLVHGIREFPGRVTSMALFEALGVPLCATAQSAETQLGAASNPLAALPIDVLSPALSQLLDKRAIIGLRNSAHTVVKMLQPVGGHSPAEALRLYSYTHPEYRETLTEYFSHEPANVMLARGTEGEVVADARRSSRIDWLHDGHQRTMVDPVGGSVADVPELPQGTDIAETAAWIRKVLDGAEPVPAPVATQVAAIKECLAQATRVTWASPL GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 13->298|YBIB_ECOLI|2e-54|43.4|279/320| SEG 299->312|aepvpapvatqvaa| BL:PDB:NREP 1 BL:PDB:REP 15->208|1o17B|5e-09|28.3|180/340| RP:PDB:NREP 1 RP:PDB:REP 15->298|2bpqA|8e-33|18.5|275/344| RP:PFM:NREP 1 RP:PFM:REP 17->76|PF02885|1e-08|43.3|60/65|Glycos_trans_3N| HM:PFM:NREP 1 HM:PFM:REP 13->77|PF02885|1.3e-16|39.3|61/66|Glycos_trans_3N| RP:SCP:NREP 2 RP:SCP:REP 15->81|1azyA1|7e-14|17.9|67/70|a.46.2.1| RP:SCP:REP 103->298|1kgzA2|3e-21|16.2|185/259|c.27.1.1| HM:SCP:REP 14->82|1khdA1|2e-14|43.5|69/69|a.46.2.1|1/1|Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain| HM:SCP:REP 86->323|1o17A2|5.4e-34|28.3|230/0|c.27.1.1|1/1|Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain| OP:NHOMO 247 OP:NHOMOORG 244 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1-------1-----------11----------------1------------------------------------------------------------11111111---11111-11111111-111---1-11------11---------------------11---------1---------1-----------------------------------------------------------------------------------------------------------------------------------1--------1-----------1-111---1-1-1----------1-11111111----122-1111111111----1--1-----------------1-------------------------------------------1111111111111111111111111111-111211111111111111----------------111-----------------------------1--------------------------------1-------------1-------1---1----1-1------1111-111111111111-111111111111111111111111---11111111111-1-1111111111--111111111111--------------11-1---------------1111111---1-111-1111111111111---------11111-----11111--------------11-------------------------------------------------1--11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 86.6 SQ:SECSTR ############HHHHHHHHHHHTTccccTTHHHHHHHHHHTTcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccTcTTcEEEEEcccTTcccHHHHHHHHHHHHHTTccEEEEEcccGGGcccccHHHHHHTTccccccHHHHHHHHHHHHHcEEEEEHHHHccccTTHHHHHHHHccccGGGTcGGGccTTccHcEEEEEcccHHHHHHHHHHHHHTTcEHHHHEEEEEETTccccccccccEEEEEEETTEEEEcGGGGTcccccGGGG#ccccHHHHHHHHHHHHTT############################### DISOP:02AL 1-3| PSIPRED ccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHccccccccHHHHHHHHHHccccEEEEEcHHHcHHHHHHHHHHHHHccccHHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccEEEcccccEEEEEEEccEEEEEEcHHHccccccHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccc //