[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07164.1
DDBJ      :             response regulator receiver (CheY-like) and ANTAR domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  239/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   77->218 1sd5A PDBj 4e-15 31.0 %
:RPS:PDB   29->153 1d4zA PDBj 7e-07 19.8 %
:RPS:SCOP  30->150 1m5tA  c.23.1.1 * 6e-07 18.1 %
:HMM:SCOP  18->215 1qo0D_ c.23.1.3 * 2.9e-41 37.6 %
:RPS:PFM   162->215 PF03861 * ANTAR 2e-08 44.4 %
:HMM:PFM   160->215 PF03861 * ANTAR 2.2e-22 44.6 56/56  
:HMM:PFM   41->140 PF00072 * Response_reg 5.5e-09 23.0 100/112  
:BLT:SWISS 77->218 PDTAR_MYCTU 1e-14 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07164.1 GT:GENE ABF07164.1 GT:PRODUCT response regulator receiver (CheY-like) and ANTAR domain protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(294684..295343) GB:FROM 294684 GB:TO 295343 GB:DIRECTION - GB:PRODUCT response regulator receiver (CheY-like) and ANTAR domain protein GB:PROTEIN_ID ABF07164.1 GB:DB_XREF GI:93353075 InterPro:IPR001789 InterPro:IPR005561 LENGTH 219 SQ:AASEQ MHRNQAPSMTRRHPPPSAVAPPATTSRSLRILLVRDPHEADPLNVETIRAGLAQAGFTEVQTVDADLRLPDTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERVKTVLDVAYARFQLDQQLRAELDATKLKLAERKTVERAKGLLMQARGISEDEAFKRLRSMAMERGIRLVDAAQRVIDVMA GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 77->218|PDTAR_MYCTU|1e-14|31.0|142/205| SEG 11->28|rrhpppsavappattsrs| BL:PDB:NREP 1 BL:PDB:REP 77->218|1sd5A|4e-15|31.0|142/188| RP:PDB:NREP 1 RP:PDB:REP 29->153|1d4zA|7e-07|19.8|121/128| RP:PFM:NREP 1 RP:PFM:REP 162->215|PF03861|2e-08|44.4|54/56|ANTAR| HM:PFM:NREP 2 HM:PFM:REP 160->215|PF03861|2.2e-22|44.6|56/56|ANTAR| HM:PFM:REP 41->140|PF00072|5.5e-09|23.0|100/112|Response_reg| RP:SCP:NREP 1 RP:SCP:REP 30->150|1m5tA|6e-07|18.1|116/123|c.23.1.1| HM:SCP:REP 18->215|1qo0D_|2.9e-41|37.6|189/0|c.23.1.3|1/1|CheY-like| OP:NHOMO 259 OP:NHOMOORG 239 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-111111111111111111111111111111111111111111-11111111-----------------------------------------------------------------33322---21------------------------------------------11-------------------------------1---------1----------------1----1-----------------------------------------------------------1----------1-1------------1-------1------22--122--1-1-----1---11111-----11111--111-11------------1111111111--1111111111111212-111----1--11111111----1----------------------------------111-----11111111111111111111-11111111--1111211111212111-11111-------------1----------------1-111111-----------------------------------------1-1-------------------------1----------11------------------------------------11------------------------------------------------------11-11---------------1-111-1---1-11111-11111112111---------2-----------------1111-11----11----------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 86.8 SQ:SECSTR ############################ccEEEEccTTcccHHHHHHHHHHHHHTTcccEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcTTccEEEEEccccHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHHHHTcHHTTccHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHTccHHHHHHHHHHHH# DISOP:02AL 1-18| PSIPRED ccccccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccEEEEEccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHc //