[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07177.1
DDBJ      :             outer membrane lipoprotein LolB
Swiss-Prot:LOLB_RALME   RecName: Full=Outer-membrane lipoprotein lolB;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.125.1
:204 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  20->200 1iwmA_ b.125.1.2 * 5.6e-41 38.6 %
:RPS:PFM   56->199 PF03550 * LolB 9e-21 46.3 %
:HMM:PFM   41->199 PF03550 * LolB 5e-40 36.6 145/157  
:BLT:SWISS 23->204 LOLB_RALME e-105 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07177.1 GT:GENE ABF07177.1 GT:PRODUCT outer membrane lipoprotein LolB GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(306639..307253) GB:FROM 306639 GB:TO 307253 GB:DIRECTION - GB:PRODUCT outer membrane lipoprotein LolB GB:PROTEIN_ID ABF07177.1 GB:DB_XREF GI:93353088 InterPro:IPR004565 LENGTH 204 SQ:AASEQ MLRSRRLALLCLATPLWLAACASVTPTRGFDASETAASQLYTGRFSANYVRYGRNEGVQGSFRWQEQGRNVRLDLVSPLGQTLAIVTATPSGATLDLPNEAPRNAPEVDSLMEQALGFSLPVSGMRDWLHGRAAPGTPSNVTRDANGRPDTLRQSGWTVRYLAWQDTPENATPTTTLPRRIDMARDGNESPLSVRLVIDPENKE GT:EXON 1|1-204:0| SW:ID LOLB_RALME SW:DE RecName: Full=Outer-membrane lipoprotein lolB;Flags: Precursor; SW:GN Name=lolB; OrderedLocusNames=Rmet_0291; SW:KW Cell membrane; Cell outer membrane; Chaperone; Complete proteome;Lipoprotein; Membrane; Palmitate; Protein transport; Signal;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 23->204|LOLB_RALME|e-105|100.0|182/204| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 2->22|lrsrrlallclatplwlaaca| RP:PFM:NREP 1 RP:PFM:REP 56->199|PF03550|9e-21|46.3|134/152|LolB| HM:PFM:NREP 1 HM:PFM:REP 41->199|PF03550|5e-40|36.6|145/157|LolB| GO:PFM:NREP 2 GO:PFM GO:0009279|"GO:cell outer membrane"|PF03550|IPR004565| GO:PFM GO:0015031|"GO:protein transport"|PF03550|IPR004565| HM:SCP:REP 20->200|1iwmA_|5.6e-41|38.6|166/177|b.125.1.2|1/1|Prokaryotic lipoproteins and lipoprotein localization factors| OP:NHOMO 96 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111------11---11111111--------111-11---------------------------------------------------------11----1----------------------------1111---------------------------------------------------------------------------------------------------------11------------------------11111111111111111111------------------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,202-205| PSIPRED cccccEEEEEEEccHHHHHHccccccccccccccEEHHHcccEEEEEEEEEEcccccEEEEEEEEEccccEEEEEEEccccEEEEEEEcccEEEEEEccccEEEcccHHHHHHHHHcccccHHccHHHHcccccccccHHEEEcccccEEEEEEccEEEEEEEEEccccccccccccccEEEEEcccccccEEEEEEEcccccc //