[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07182.1
DDBJ      :             peptidase S16, lon-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  139/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->183 1zboB PDBj 8e-15 36.7 %
:RPS:PDB   18->126 2aneB PDBj 7e-19 18.9 %
:RPS:SCOP  18->198 1zboA1  b.122.1.10 * 8e-38 33.7 %
:HMM:SCOP  16->213 1zboA1 b.122.1.10 * 2.8e-49 40.1 %
:RPS:PFM   18->205 PF02190 * LON 5e-10 30.5 %
:HMM:PFM   18->212 PF02190 * LON 3.6e-28 23.2 194/207  
:BLT:SWISS 1->141 CRBN_HUMAN 6e-12 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07182.1 GT:GENE ABF07182.1 GT:PRODUCT peptidase S16, lon-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(313990..314643) GB:FROM 313990 GB:TO 314643 GB:DIRECTION - GB:PRODUCT peptidase S16, lon-like protein GB:PROTEIN_ID ABF07182.1 GB:DB_XREF GI:93353093 InterPro:IPR003111 LENGTH 217 SQ:AASEQ MSTFLSGTASDSATLDALPLFPLHTVLFPDGRLPLRVFEKRYVDMVRNCMRDHLPFGVCLIATGEEVAQPGQTTEPESIGCLAEIVDCNVEQLGVLLIETRGRQRFRVLSHATRDDGLLVANVELLPPDVIDCKLELLGECLAALRRIVTSLHTDQPDKPKLPFGEPYLWDDPSWVVNRLCELLPVPLKAKQMLMELPDAGVRIEIVHRYMRQHHIV GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 1->141|CRBN_HUMAN|6e-12|35.6|135/442| BL:PDB:NREP 1 BL:PDB:REP 18->183|1zboB|8e-15|36.7|158/194| RP:PDB:NREP 1 RP:PDB:REP 18->126|2aneB|7e-19|18.9|106/108| RP:PFM:NREP 1 RP:PFM:REP 18->205|PF02190|5e-10|30.5|187/203|LON| HM:PFM:NREP 1 HM:PFM:REP 18->212|PF02190|3.6e-28|23.2|194/207|LON| GO:PFM:NREP 2 GO:PFM GO:0004176|"GO:ATP-dependent peptidase activity"|PF02190|IPR003111| GO:PFM GO:0006508|"GO:proteolysis"|PF02190|IPR003111| RP:SCP:NREP 1 RP:SCP:REP 18->198|1zboA1|8e-38|33.7|181/197|b.122.1.10| HM:SCP:REP 16->213|1zboA1|2.8e-49|40.1|197/0|b.122.1.10|1/1|PUA domain-like| OP:NHOMO 191 OP:NHOMOORG 168 OP:PATTERN -------------------------------------------------------------------- 1-1-1---------11111-11--111111111----------------------------11-1-11-----------------------------------------------------------------------11---1--------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111111111111111111111111111-11111111111111111-1----------------11---------------------------------------------------------1122111--11--2-----111-11---111-----111--------------------------------------------------------------------------------------------1-----------1---------------------------1-11111111111111-11-------------21111111--11111111111------1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-1-----11---1-11-1-5C1-112--1-1-111---111-12-131----------------1-------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 74.2 SQ:SECSTR #################EEEEEEcccccTTcEEEEEEccHHHHHHHHHHHHTTcEEEEEEccccccccccccTTccccEEEEEEEEEEEEcTTccEEEEEEEEEEEEEEEEEEEccccEEEEEEEccc###ccccccGHHHHHHHHHHHHHHHHHTc#cTTTc#cccccTTcHHHHHHHHHHc################################## DISOP:02AL 1-5,7-7,66-68,159-160,217-218| PSIPRED ccccccccccccccEEEEEEEEEccEEccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHcccc //