[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07187.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07187.1 GT:GENE ABF07187.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(317851..318141) GB:FROM 317851 GB:TO 318141 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF07187.1 GB:DB_XREF GI:93353098 LENGTH 96 SQ:AASEQ MMGARRTRRWRTRYPSTSPATFGQPGVFATDAARCMLRHTTTTDRTAPDNRPGIPRGKRSRDGGWQFSGWAIRPASSRHHSRRRRRSAQVRSGPAL GT:EXON 1|1-96:0| SEG 5->13|rrtrrwrtr| SEG 76->87|ssrhhsrrrrrs| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,47-59,75-93,95-97| PSIPRED ccccccccHHHcccccccccccccccEEEccHHHHHHHHcccccccccccccccccccccccccEEEccEEEcccccHHHHHHHHHHHHHHccccc //