[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07191.1
DDBJ      :             OstA-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  86/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->159 2r19A PDBj 7e-08 29.7 %
:RPS:SCOP  31->115 1qyiA  c.108.1.13 * 8e-05 16.7 %
:RPS:PFM   31->77 PF03968 * OstA 5e-06 48.9 %
:HMM:PFM   18->164 PF03968 * OstA 8.5e-33 39.0 136/145  
:BLT:SWISS 32->190 LPTA_HAEIN 4e-12 32.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07191.1 GT:GENE ABF07191.1 GT:PRODUCT OstA-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(321037..321681) GB:FROM 321037 GB:TO 321681 GB:DIRECTION - GB:PRODUCT OstA-like protein GB:PROTEIN_ID ABF07191.1 GB:DB_XREF GI:93353102 InterPro:IPR005653 LENGTH 214 SQ:AASEQ MTASLTTSSCRRTAPALMAAIAAIGLFLAQPAFAERADQTKPLVLEADNASYDDVKQIYTLTGNVVLTKGTMVLKSDAAELRTDPEGYQYAIATSKPGRQAYIRQKRDGVDEYIDGWGDRIEYDGKSEINKLIGNARAARVSGVGAKILDEIRGAVITYDSRNEFYTATGGDNNASAGNPSGRVRAVLSPRANQASAPAGAPLDLKPSSQPAKP GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 32->190|LPTA_HAEIN|4e-12|32.2|143/172| SEG 14->29|apalmaaiaaiglfla| BL:PDB:NREP 1 BL:PDB:REP 38->159|2r19A|7e-08|29.7|111/135| RP:PFM:NREP 1 RP:PFM:REP 31->77|PF03968|5e-06|48.9|47/159|OstA| HM:PFM:NREP 1 HM:PFM:REP 18->164|PF03968|8.5e-33|39.0|136/145|OstA| RP:SCP:NREP 1 RP:SCP:REP 31->115|1qyiA|8e-05|16.7|72/380|c.108.1.13| OP:NHOMO 86 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111-1111111111111111111111111111111111111111111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111----------1---------1--1111111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 55.1 SQ:SECSTR #################################ccTTGGGccEEEEccEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEEccccTTcEEEEEccccTTcEEEEccTT#cccEEEEccEEEEEGGGTEEEEEEEEEEEETT#######EEEEEEEEEE####################################################### DISOP:02AL 1-8,168-215| PSIPRED ccEEEcccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEccEEEEEEEEEEEEcccccEEEEEEEccccEEEEEEEEcccccEEEEEEEEEEEEccccEEEEEccEEEEEccccccccccEEEEEEEEEEccEEEEEEEcccccccccccccEEEEEEccccccccccccccHHcccccccccc //