[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07195.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->87 PF11575 * FhuF_C 0.00025 55.6 9/22  
:HMM:PFM   23->64 PF06303 * MatP 0.0002 33.3 42/148  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07195.1 GT:GENE ABF07195.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(325477..325905) GB:FROM 325477 GB:TO 325905 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07195.1 GB:DB_XREF GI:93353106 LENGTH 142 SQ:AASEQ MCEIFIRANPDSYQTQSRSLRLHGMATSIRLENLFWEVLEELAQRDGMTVNQLLTRLHDELAEHRGETSLSANFASFLRVCCMRYLLLQNDGRIPADTSVPIRSLDARAVLDSLPASWVEAGNSPLPRAARGEHASASSSSP GT:EXON 1|1-142:0| HM:PFM:NREP 2 HM:PFM:REP 79->87|PF11575|0.00025|55.6|9/22|FhuF_C| HM:PFM:REP 23->64|PF06303|0.0002|33.3|42/148|MatP| OP:NHOMO 86 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--------11111111112---1--1-------11-11-111--11---1-2----1----------1------------------------------------------11111-------------21--------21111--221-1-11-1-1-1---------------------1----------1------------------------------------------------1---1---1----------1111-1--1-2----1----------------------------------------------------------------------------------------------------------1-1---------------------------1111-1--1-------------------11------11-11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 122-143| PSIPRED cccccccccHHHcEEEEEEEEEccEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHcccccccHHHHHHHcccccccc //