[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07201.1
DDBJ      :             single-strand binding protein
Swiss-Prot:SSB_RALEH    RecName: Full=Single-stranded DNA-binding protein;         Short=SSB;AltName: Full=Helix-destabilizing protein;

Homologs  Archaea  0/68 : Bacteria  865/915 : Eukaryota  55/199 : Viruses  17/175   --->[See Alignment]
b.40.4
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->108 1eygA PDBj 2e-41 70.5 %
:RPS:PDB   2->108 3eivD PDBj 3e-33 27.6 %
:RPS:SCOP  3->108 1eqqA  b.40.4.3 * 8e-39 66.0 %
:HMM:SCOP  3->181 1se8A_ b.40.4.3 * 1.3e-62 47.2 %
:RPS:PFM   4->108 PF00436 * SSB 2e-33 59.6 %
:HMM:PFM   4->108 PF00436 * SSB 1e-45 56.7 104/104  
:BLT:SWISS 1->108 SSB_RALEH 8e-56 92.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07201.1 GT:GENE ABF07201.1 GT:PRODUCT single-strand binding protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 333925..334470 GB:FROM 333925 GB:TO 334470 GB:DIRECTION + GB:PRODUCT single-strand binding protein GB:PROTEIN_ID ABF07201.1 GB:DB_XREF GI:93353112 InterPro:IPR000424 InterPro:IPR010913 InterPro:IPR011344 LENGTH 181 SQ:AASEQ MASVNKVILVGNLGADPETRYMPSGDAVTNIRLATTDRYKDKQSGEFKEATEWHRIAFFGKLAEIAGQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVADQMQMLGGRGQGGGGDEGGYGGGAGGGAGGGGGYSRESQGGGGRSQGGGAQGGGQQGGQRRQQQAPSNGFEDMDDDIPF GT:EXON 1|1-181:0| SW:ID SSB_RALEH SW:DE RecName: Full=Single-stranded DNA-binding protein; Short=SSB;AltName: Full=Helix-destabilizing protein; SW:GN Name=ssb; OrderedLocusNames=PHG335; SW:KW Complete proteome; DNA damage; DNA repair; DNA replication;DNA-binding; Plasmid. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->108|SSB_RALEH|8e-56|92.6|108/188| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| SEG 109->166|ggrgqggggdeggygggagggagggggysresqggggrsqgggaqgggqqggqrrqqq| BL:PDB:NREP 1 BL:PDB:REP 4->108|1eygA|2e-41|70.5|105/112| RP:PDB:NREP 1 RP:PDB:REP 2->108|3eivD|3e-33|27.6|98/100| RP:PFM:NREP 1 RP:PFM:REP 4->108|PF00436|2e-33|59.6|104/104|SSB| HM:PFM:NREP 1 HM:PFM:REP 4->108|PF00436|1e-45|56.7|104/104|SSB| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00436|IPR000424| RP:SCP:NREP 1 RP:SCP:REP 3->108|1eqqA|8e-39|66.0|106/114|b.40.4.3| HM:SCP:REP 3->181|1se8A_|1.3e-62|47.2|176/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 1317 OP:NHOMOORG 937 OP:PATTERN -------------------------------------------------------------------- 212222211121211-111-1111111111111111111111121111111122112111111111211111---2112222111111121212111--11224211121--------------1222222222223333311131112111-11111111111112221111111111111111-1111-21222222222121112111221221122321113112211133222222124432221121511111121111-112211111142342232322222222232322214332333222332222222222121321212243532112212322122411211211311111111211-1211311215417111122121111111111111113-11111111311111111111111112111114121113111111111111112111111111111111111111111111111115332111112211112111112211111111131122211431121311211121211111121111111111111121211111211111111212113111112111121211312111111111111111331111211111111111111211211111111-2111111111111112111221121221-211224211122122122131111123211121112132221331111111111111111111111111111112222111111111212311222211111221111111111111211121112111111111111211111211111111111111114324111111111111121111111--11------------------111111-111111111 11------1----------------------------------------------------------------------------------------------11------111-111-----142-11741-111--1-2-11111-1-11-2-1112---13---2111-1211----111-1---1---111---- -----------------------------1-----------1---1--------------1-----------------1---11---------------------1-111------------1----11-----111-------------------------------------- STR:NPRED 108 STR:RPRED 59.7 SQ:SECSTR cccccEEEEEEEEccccEEEEcTTccEEEEEEEEEcccEEETTTTEEccccEEEEEEEEHHHHHHHHHHccTTcEEEEEEEEEEEccEEEEEEEEEEEcccccccccc######################################################################### DISOP:02AL 1-1,42-44,133-171| PSIPRED ccccEEEEEEEEEccccEEEEcccccEEEEEEEEEccccccccccccccccEEEEEEEEcHHHHHHHHHcccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHccccccc //