[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07205.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->45 PF07278 * DUF1441 0.00022 32.1 28/152  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07205.1 GT:GENE ABF07205.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(337641..337856) GB:FROM 337641 GB:TO 337856 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF07205.1 GB:DB_XREF GI:93353116 LENGTH 71 SQ:AASEQ MTFHQPSGIAQGLPLLIDANWTPAQAWAVIELLDDLRDRLHAHYQLALAQWLAEDRQEHPDGLGDLADNDF GT:EXON 1|1-71:0| SEG 32->40|llddlrdrl| HM:PFM:NREP 1 HM:PFM:REP 18->45|PF07278|0.00022|32.1|28/152|DUF1441| OP:NHOMO 13 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C-----------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,69-72| PSIPRED cccccHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccc //