[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07218.1
DDBJ      :             Glyoxalase/bleomycin resistance protein/dioxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->115 2ei0A PDBj 6e-10 13.9 %
:RPS:SCOP  1->131 1dhyA2  d.32.1.3 * 2e-09 13.2 %
:HMM:SCOP  1->121 1q0oA2 d.32.1.3 * 6.9e-14 22.9 %
:HMM:PFM   5->112 PF00903 * Glyoxalase 1.4e-05 16.8 107/128  
:BLT:SWISS 1->155 YQCK_BACSU 6e-23 37.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07218.1 GT:GENE ABF07218.1 GT:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(350298..350786) GB:FROM 350298 GB:TO 350786 GB:DIRECTION - GB:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GB:PROTEIN_ID ABF07218.1 GB:DB_XREF GI:93353129 InterPro:IPR004360 LENGTH 162 SQ:AASEQ MKRFHVHVSVADLPASIRYYSALFDAEPTVVRDDYAKWALDDPRVNFAISNRTEKLGVDHLGIQVETDAELAEMQGRLASADLPMQSQSETNCCYATSNKHWSVDPTGIAWESFHTLGNVPTYGESRDRSAEASACCVPVQLNATPKPSTKTACCTPESGCC GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 1->155|YQCK_BACSU|6e-23|37.5|144/146| RP:PDB:NREP 1 RP:PDB:REP 1->115|2ei0A|6e-10|13.9|115/286| HM:PFM:NREP 1 HM:PFM:REP 5->112|PF00903|1.4e-05|16.8|107/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->131|1dhyA2|2e-09|13.2|129/146|d.32.1.3| HM:SCP:REP 1->121|1q0oA2|6.9e-14|22.9|118/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 102 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- --------------11-11-12--1111111121211-11-111---1------------11---111111-----------------------------------------------------------------------------------------------1-1----------------------1--11111111-1111111----1111----1--------1---------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------1-----------------1---------------------------------------------------------1-1-----1-------111-221-1111-1---1111--33-11-111----------11--------------------------------------------1-----------------------------------------------------------------1------------------------------------------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 98.8 SQ:SECSTR EEEEEEEEEcccHHHHHHHHHHTTccEEEccccTTEEEEEcccccccEEEEcccccEEEEEEEEEccHHHHHHHHHHHHHTTcccEEccHHHHHHHTEEEEEEEcTTccEEEEEEEEcccTTcccccccccccccccGGGcccccTTEEEEEEEEEETcc## DISOP:02AL 1-1,125-134,144-148,150-152| PSIPRED cccEEEEEEEccHHHHHHHHHHHHccEEEEEEccEEEEEEccccEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHcccEEEEccccEEEEccccEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccc //