[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07227.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  300/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:453 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->161 1pw4A PDBj 7e-04 28.0 %
:RPS:SCOP  21->161 1pw4A  f.38.1.1 * 2e-12 21.4 %
:HMM:SCOP  1->453 1pw4A_ f.38.1.1 * 6.7e-87 31.2 %
:RPS:PFM   44->333 PF07690 * MFS_1 2e-15 28.8 %
:HMM:PFM   44->411 PF07690 * MFS_1 2.1e-48 24.5 347/353  
:HMM:PFM   420->443 PF00746 * Gram_pos_anchor 0.00029 50.0 24/39  
:BLT:SWISS 19->424 PHT1_PSEPU 5e-74 43.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07227.1 GT:GENE ABF07227.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 358986..360347 GB:FROM 358986 GB:TO 360347 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:PROTEIN_ID ABF07227.1 GB:DB_XREF GI:93353138 InterPro:IPR007114 InterPro:IPR011701 LENGTH 453 SQ:AASEQ MHTQSLGAAPVLPEIPSHAIPQVLPTQQEDALYRKVWLRIIPFLFICYVVSFLDRINIGFAQLQMKHDLGFSDAMYGLGAAVFYVGYVLCEVPSNMLLARFGARRTFTRIMLLWGVASVGMMLVSQPSHFYLLRFLLGVFEAGFFPGIVLYLTYWFPARRRAAVMAIFFAGVAVAGVLGGLISGWIMRDMAGVLGMRGWQWMFAIEGAPAVLLGLIAAVCLVDGPRQARWLTPAEQDYLVAQHEAESRGAGGHAHSMQALRQALANPRVYLFAFIYFALTCGSLTLSFWMPLMIRDFGIQDVVAVSLYSVIPNAIGAVGLILIARRSDRLGERHGHFLCCTAGGALALAALTLHVPSLGVSLAILSVAAVLIFAALPIFWALPPSHLPAQTAATGIAFISSIGITSGIVSPWVIGQIKAHTGSMDNALYLLAGLLLASGLALWKGVPRTPTAH GT:EXON 1|1-453:0| BL:SWS:NREP 1 BL:SWS:REP 19->424|PHT1_PSEPU|5e-74|43.3|406/451| TM:NTM 12 TM:REGION 36->58| TM:REGION 75->97| TM:REGION 106->128| TM:REGION 132->154| TM:REGION 162->184| TM:REGION 203->225| TM:REGION 268->290| TM:REGION 302->324| TM:REGION 335->357| TM:REGION 363->385| TM:REGION 396->418| TM:REGION 424->446| SEG 162->182|aavmaiffagvavagvlggli| SEG 338->353|lcctaggalalaaltl| SEG 391->408|taatgiafissigitsgi| SEG 427->442|alyllaglllasglal| BL:PDB:NREP 1 BL:PDB:REP 24->161|1pw4A|7e-04|28.0|125/434| RP:PFM:NREP 1 RP:PFM:REP 44->333|PF07690|2e-15|28.8|271/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 44->411|PF07690|2.1e-48|24.5|347/353|MFS_1| HM:PFM:REP 420->443|PF00746|0.00029|50.0|24/39|Gram_pos_anchor| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 21->161|1pw4A|2e-12|21.4|140/434|f.38.1.1| HM:SCP:REP 1->453|1pw4A_|6.7e-87|31.2|426/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 3886 OP:NHOMOORG 414 OP:PATTERN ------1-1111112----------------------------2-----------------1------ 224-------1------11-1---1611111--2221235----2-------1-2--------11-A-2-------------1----------------------1-3-2--------------1------------------------1-------------------------------------------1-----------------33-2-----21---1-111---11111111111111111111-------1------------------------------------------------------------------2----------------------------31-11----1-------1-12222-----61744--1-6--111111111112-23E11I3C----6112121311--621----1-------31333333144--1---------------------------------121-1----JNQUOJ76553QQQR888829IDJ9DD5-1A76-----5-1-2222-----2-------------1---------1-------------------2-1-----11----------------------3-----1---------1------1-----------------43421425446556656-46467656653657757769FB6411-A397A7AAAA869678841-55551-244444444344---------------------1-----------66565-2---A-443449BF1BDDE-676--------------11111-------23233222-------------------------------------------------------------1- ------------113kl*YpefY*y**JJHGDHHJIOPLOKNNEHIQNUi****qsgJLONNV8G67A2A31JCF542434CCAOA77-QXSlPaFdLU8E8ASGL--3-------------------------------------------------1-----1----------12------36-112a--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 27.6 SQ:SECSTR #######################ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHTcccHHH##HHHHHHHHHHHHHHHHHHHHHHHHHH###HHHHHHHHHcHHHHccccHH########HHHHHHHHHHHHHTHHHHHHHHHTTcTTTHH#################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-23,242-256,450-454| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccc //