[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07249.1
DDBJ      :             molybdopterin dehydrogenase, FAD-binding
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  190/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.87.2
:266 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->205 1ffvC PDBj 3e-30 42.9 %
:RPS:PDB   24->263 2ckjA PDBj 2e-21 17.1 %
:RPS:SCOP  1->166 1rm6B2  d.145.1.3 * 2e-28 24.8 %
:RPS:SCOP  171->266 1fiqB1  d.87.2.1 * 1e-13 15.6 %
:HMM:SCOP  1->169 1rm6B2 d.145.1.3 * 2.1e-51 46.4 %
:HMM:SCOP  168->267 1n62C1 d.87.2.1 * 5.5e-20 39.0 %
:RPS:PFM   25->168 PF00941 * FAD_binding_5 2e-19 43.1 %
:HMM:PFM   3->167 PF00941 * FAD_binding_5 8.1e-53 44.2 165/171  
:HMM:PFM   172->263 PF03450 * CO_deh_flav_C 7.6e-09 31.1 90/103  
:BLT:SWISS 24->205 DCMM_HYDPS 8e-30 42.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07249.1 GT:GENE ABF07249.1 GT:PRODUCT molybdopterin dehydrogenase, FAD-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(384117..384917) GB:FROM 384117 GB:TO 384917 GB:DIRECTION - GB:PRODUCT molybdopterin dehydrogenase, FAD-binding GB:PROTEIN_ID ABF07249.1 GB:DB_XREF GI:93353160 InterPro:IPR002346 LENGTH 266 SQ:AASEQ MYAFQYERAADANAAVAKLKADGDAKFLAGGQSLLAAMKLRLASPSTLVDVSRIPGMNGIRVEGDALVIGAATRHADVAANADVMRRIPALAALANGIGDRQVRAMGTIGGSLANDDPAADYPAAVLGLNATVVTDRRSIAADDFFKGLYETALEPDELITAVRFPSPDQAAYIKFRNPASRFALVGVMVARTGKTVRVAVTGAADSVFRAPALEQALAASFTPAAARAVKMDPSGLNVDLHASAEYRAHLIPVLAARAVEQALKG GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 24->205|DCMM_HYDPS|8e-30|42.9|182/287| SEG 9->22|aadanaavaklkad| SEG 114->125|anddpaadypaa| BL:PDB:NREP 1 BL:PDB:REP 24->205|1ffvC|3e-30|42.9|182/287| RP:PDB:NREP 1 RP:PDB:REP 24->263|2ckjA|2e-21|17.1|240/1264| RP:PFM:NREP 1 RP:PFM:REP 25->168|PF00941|2e-19|43.1|144/171|FAD_binding_5| HM:PFM:NREP 2 HM:PFM:REP 3->167|PF00941|8.1e-53|44.2|165/171|FAD_binding_5| HM:PFM:REP 172->263|PF03450|7.6e-09|31.1|90/103|CO_deh_flav_C| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00941|IPR002346| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00941|IPR002346| RP:SCP:NREP 2 RP:SCP:REP 1->166|1rm6B2|2e-28|24.8|165/216|d.145.1.3| RP:SCP:REP 171->266|1fiqB1|1e-13|15.6|96/114|d.87.2.1| HM:SCP:REP 1->169|1rm6B2|2.1e-51|46.4|168/0|d.145.1.3|1/1|FAD-binding domain| HM:SCP:REP 168->267|1n62C1|5.5e-20|39.0|100/109|d.87.2.1|1/1|CO dehydrogenase flavoprotein C-terminal domain-like| OP:NHOMO 374 OP:NHOMOORG 212 OP:PATTERN 112---2322223323--21111--------------------------------------1------ --211------------11-12--241111111333-1461-13--------1-11----1-7--363231-----------3-----------------------------------------------------11111----5-----1-----------------1--------------1----------------------------------11-------------------------------------------------------------------------------------------------------22--1111111-1-----------------1----22--111----------1-1--------54621224363111111111-1-22521424431-2--11132112512---43-1111214--------3--1-111--------------------------------1--2221--------------24--------73571--221-----1-1-21-1-----------------11---1------1------1111---------1-1---------------------------1-----1-1-------------------------1------------1--11--1----1-11111--1111-111111--------------------------1--111------------------------------1----------------------------1--------------1---------------1------------1-1---------------------------------------------------------2--------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 91.4 SQ:SECSTR #######################TcEEccccTTHHHHHHHccccccEEEEccccGGGccEEEcccEEEEETTccHHHHHHHHTTTHHHHHHHHHHTTcccHHHHTTccHHHHHHcccTTcccHHHHHHHTcccETccccccccTTccccTTccccTTcEEEEEEEEcccTTEEEEEEEEccccccEEEEEEEEccTTEEEEETcccccEEcTHHHHHHcHHHHHHHHHHHHHHTcccTTcTTccHHHHHHHHHHHHHHHHHHHHHH PSIPRED cccccEEEcccccccEEEEEcccccEEEEccccHHHHHHcccccccEEEEccccccccEEEEEccEEEEEccccHHHHHHcHHHHHHHHHHHHHHHHHccHHHccEEEccccccccccccccHHHHHHcccEEEEEEEEEEHHHHcccccccccccccEEEEEEEEccccccEEEEEEccccccEEEEEEEccccEEEEEEEcccccEEEHHHHHHHHcccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcc //