[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07258.1
DDBJ      :             import inner membrane translocase, subunit Tim44
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  129/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:329 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  204->327 2cw9A1  d.17.4.13 * 9e-26 16.1 %
:HMM:SCOP  196->329 2cw9A1 d.17.4.13 * 4.5e-11 21.6 %
:RPS:PFM   210->326 PF04280 * Tim44 1e-12 36.8 %
:HMM:PFM   197->327 PF04280 * Tim44 2.4e-34 31.3 131/147  
:HMM:PFM   70->140 PF07690 * MFS_1 0.00017 27.1 70/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07258.1 GT:GENE ABF07258.1 GT:PRODUCT import inner membrane translocase, subunit Tim44 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 396681..397670 GB:FROM 396681 GB:TO 397670 GB:DIRECTION + GB:PRODUCT import inner membrane translocase, subunit Tim44 GB:PROTEIN_ID ABF07258.1 GB:DB_XREF GI:93353169 InterPro:IPR007379 LENGTH 329 SQ:AASEQ MSSFRGKFLAMSLIATLALGAALDANAKRLGGSRSIGKQSSGVTQQRQQAPAQQNTPPAQQPAQAAPATAGAAGAAGGAAAAAAPKRNWGGMLGGLAAGLGIGYLLSHFGLGGAAASILSNVILFGVIALIAMWLIRKFRGGSARTQQPSYAGMGGNGSNYGGPSHAEPTLRTAEPVGNGGAASNPVMGGAAAAATAAAVQQPWGVPADFDTESFLRNAKVHYVRLQAAWDAGNQDDIREFTTPEMFAEIKMDLSERGSEVNKTDVVTLDAQLLGIESTPAQHIASVRFSGMIREKAGEPAQPFGEVWNLAKATSGNGGWLLAGIQQES GT:EXON 1|1-329:0| TM:NTM 3 TM:REGION 7->27| TM:REGION 92->111| TM:REGION 117->136| SEG 44->85|tqqrqqapaqqntppaqqpaqaapatagaagaaggaaaaaap| SEG 90->106|ggmlgglaaglgigyll| SEG 150->163|syagmggngsnygg| SEG 191->199|aaaaataaa| RP:PFM:NREP 1 RP:PFM:REP 210->326|PF04280|1e-12|36.8|117/147|Tim44| HM:PFM:NREP 2 HM:PFM:REP 197->327|PF04280|2.4e-34|31.3|131/147|Tim44| HM:PFM:REP 70->140|PF07690|0.00017|27.1|70/353|MFS_1| GO:PFM:NREP 3 GO:PFM GO:0005744|"GO:mitochondrial inner membrane presequence translocase complex"|PF04280|IPR007379| GO:PFM GO:0006886|"GO:intracellular protein transport"|PF04280|IPR007379| GO:PFM GO:0015450|"GO:P-P-bond-hydrolysis-driven protein transmembrane transporter activity"|PF04280|IPR007379| RP:SCP:NREP 1 RP:SCP:REP 204->327|2cw9A1|9e-26|16.1|124/182|d.17.4.13| HM:SCP:REP 196->329|2cw9A1|4.5e-11|21.6|134/0|d.17.4.13|1/1|NTF2-like| OP:NHOMO 133 OP:NHOMOORG 129 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111121111111112111111111111111211111121-1-11-------111111-----1111111111--------------------------------------------111------1-11111------1-1--1-----------------------------------------------------------------------------------------------------------11111--11---------------1111111---1-11111111111111111---------1111111-11111-1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,28-72,140-186,328-330| PSIPRED cHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccccccHHHHHHHccHHcccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEcccccccEEEEEEEEEEEccccccccEEEEEEEcc //