[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07262.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  155/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->33 PF09723 * CxxC_CxxC_SSSS 5e-08 60.6 %
:HMM:PFM   1->39 PF09723 * CxxC_CxxC_SSSS 1.1e-17 50.0 38/42  
:BLT:SWISS 1->34 FMDB_METME 1e-04 51.5 %
:BLT:SWISS 6->51 RPOB_AQUPY 9e-04 44.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07262.1 GT:GENE ABF07262.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 402076..402405 GB:FROM 402076 GB:TO 402405 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07262.1 GB:DB_XREF GI:93353173 LENGTH 109 SQ:AASEQ MPIYAYRCDACGYGRDVLQKMSDAPLTDCPSCGAAGTYKKQLTAAGFQLKGSGWYVTDFRGGSGGTSAPATSGNATAPAAPAASAESSTASTTSAAPAAGGCGDSCACH GT:EXON 1|1-109:0| BL:SWS:NREP 2 BL:SWS:REP 1->34|FMDB_METME|1e-04|51.5|33/112| BL:SWS:REP 6->51|RPOB_AQUPY|9e-04|44.2|43/1469| SEG 61->101|ggsggtsapatsgnatapaapaasaesstasttsaapaagg| RP:PFM:NREP 1 RP:PFM:REP 1->33|PF09723|5e-08|60.6|33/41|CxxC_CxxC_SSSS| HM:PFM:NREP 1 HM:PFM:REP 1->39|PF09723|1.1e-17|50.0|38/42|CxxC_CxxC_SSSS| OP:NHOMO 156 OP:NHOMOORG 156 OP:PATTERN -------------------------------------------------------------------- 11111--------------------------------------1-1---1-11111-1---1-1---1111-----------------------------------------------------111111111111111-1---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------111111111111-11111111111111111111--11111111111111111111111-------111111-1111----1------1-1111---1--1-11-------------------------11--1--1---------------------------1111----------1--------------------------------------------------------1-------------------------1111111111-11--------------------------11----1111-1111------------------------------11111111---------------------------------------------------1----------- -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 66-97| PSIPRED cccEEEEEcccccEEEEEEEccccHHHHcccccccccEEEEEEccEEEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccc //