[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07271.1
DDBJ      :             acyl-CoA dehydrogenase-like protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  501/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:595 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   81->448 2jifB PDBj 2e-30 29.8 %
:RPS:PDB   3->571 3djlA PDBj 1e-86 18.5 %
:RPS:SCOP  37->281 1rx0A2  e.6.1.1 * 3e-37 25.5 %
:RPS:SCOP  289->478 1is2A1  a.29.3.2 * 3e-30 19.9 %
:HMM:SCOP  37->297 1is2A3 e.6.1.2 * 9e-61 39.1 %
:HMM:SCOP  287->477 1is2A1 a.29.3.2 * 1e-51 39.2 %
:RPS:PFM   4->35 PF12418 * AcylCoA_DH_N 2e-06 56.2 %
:RPS:PFM   81->158 PF02771 * Acyl-CoA_dh_N 4e-06 34.6 %
:RPS:PFM   284->458 PF00441 * Acyl-CoA_dh_1 9e-22 42.3 %
:HMM:PFM   283->451 PF00441 * Acyl-CoA_dh_1 1.7e-24 31.2 144/150  
:HMM:PFM   3->35 PF12418 * AcylCoA_DH_N 2.6e-16 60.6 33/34  
:HMM:PFM   163->218 PF02770 * Acyl-CoA_dh_M 3.3e-16 45.1 51/52  
:HMM:PFM   41->158 PF02771 * Acyl-CoA_dh_N 1.2e-14 28.3 106/113  
:BLT:SWISS 82->455 ACDS_CLOAB 1e-31 32.5 %
:PROS 446->463|PS00216|SUGAR_TRANSPORT_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07271.1 GT:GENE ABF07271.1 GT:PRODUCT acyl-CoA dehydrogenase-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 410451..412238 GB:FROM 410451 GB:TO 412238 GB:DIRECTION + GB:PRODUCT acyl-CoA dehydrogenase-like protein GB:PROTEIN_ID ABF07271.1 GB:DB_XREF GI:93353182 InterPro:IPR005829 InterPro:IPR006090 InterPro:IPR006091 InterPro:IPR013107 LENGTH 595 SQ:AASEQ MGQYTAPLRDMQFVLHELLGAEAELKAMPQHADIDVDTINQVLEEAGKFCSDVVFPLNQPGDREGCTYVGDGVVRAPKGFKEAYQQFVEAGWPALACDPEFGGQGLPIMINNALYEMLNSAGQAWTMYPGLSHGAYEALHAHGTPELKQTYLPKLVSGVWTGTMCLTEPHCGTDLGILRSKAEPQADGSYSITGTKIFISAGEHDMAENIIHLVLARLPDAPGGTKGISLFVVPKFIPDANGNPGERNGIKCGSIEHKMGIHGNATCVMNLDGARGWMVGEPNKGLNAMFVMMNAARLGVGAQGLGLTEVAYQNSLAYAKDRLQMRSLTGPKAPDKPADPIIVHPDVRRMLLTQKAYAEGGRAFAYWTALQIDRELSHPDESVRKEAGDLVALLTPVIKAFLTDNAFTSTNEGMQVFGGHGYISEWGMEQYVRDARINMIYEGTNTVQSLDLLGRKVLGDMGAKLKAFGKIVQTFVEEEGTSEAMQEFVNPLADIGDKVQKLTMEIGMKAMGNADEVGAAAVPYLRVVGHLVFSYFWARMAKIALDKQDSGDKFYTTKLATARFYFAKLLPETAGEIRKARAGASTLMALDADLF GT:EXON 1|1-595:0| BL:SWS:NREP 1 BL:SWS:REP 82->455|ACDS_CLOAB|1e-31|32.5|332/379| PROS 446->463|PS00216|SUGAR_TRANSPORT_1|PDOC00190| BL:PDB:NREP 1 BL:PDB:REP 81->448|2jifB|2e-30|29.8|326/377| RP:PDB:NREP 1 RP:PDB:REP 3->571|3djlA|1e-86|18.5|514/538| RP:PFM:NREP 3 RP:PFM:REP 4->35|PF12418|2e-06|56.2|32/34|AcylCoA_DH_N| RP:PFM:REP 81->158|PF02771|4e-06|34.6|78/113|Acyl-CoA_dh_N| RP:PFM:REP 284->458|PF00441|9e-22|42.3|149/150|Acyl-CoA_dh_1| HM:PFM:NREP 4 HM:PFM:REP 283->451|PF00441|1.7e-24|31.2|144/150|Acyl-CoA_dh_1| HM:PFM:REP 3->35|PF12418|2.6e-16|60.6|33/34|AcylCoA_DH_N| HM:PFM:REP 163->218|PF02770|3.3e-16|45.1|51/52|Acyl-CoA_dh_M| HM:PFM:REP 41->158|PF02771|1.2e-14|28.3|106/113|Acyl-CoA_dh_N| GO:PFM:NREP 4 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 37->281|1rx0A2|3e-37|25.5|216/231|e.6.1.1| RP:SCP:REP 289->478|1is2A1|3e-30|19.9|181/189|a.29.3.2| HM:SCP:REP 37->297|1is2A3|9e-61|39.1|230/0|e.6.1.2|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 287->477|1is2A1|1e-51|39.2|181/189|a.29.3.2|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 4284 OP:NHOMOORG 693 OP:PATTERN 33----4555445645-131321B6334--45-----------------------------3541--- 4435D1-1---423DMDCC-CJ22HJCCCCCBKOROFQfe3D6K-114----112232--8AI189DCFDA---------321-----11111122---31333333513--------------------------45588---63-1---------------------1-------------66655--18735555545555555553455435556898811------52------------------------------------------------------------------------------------------1131544444444441311211--6-3-4-13-751468-17---11-3-51-EAAC-----31CC7544C9D9AAA9A9AA7977-44844B4698D15774657667787C79698C6566A89111111116----995-----------------------------1BAD816MF9GAAABDA5599988GCBBBB7AI7KJRNO23DE9B58AAJDCEHG336----46----------A873TGB-----------654-9-5--6686D866---------------------------32-6B28573-4444446544446454455---111-------213--1-2223233222-2222222212222222221111-----322-33333231311312221-11--111111111111---4111113333-A833---------------FFEDFAC7988-JIJK8FBCEBACDB658-------------2-----24-224544444444-------2888777----------1-------------------------1--11-1------ ----459-942-774656654334444441435333443444445443354577454243232--------------------------47353424233265776-984EAO89A935446A5B92F6L*B-C9J47329557534643952C5977G5594C9A45589AD7E211--2112221275123185557 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 590 STR:RPRED 99.2 SQ:SECSTR ##ccccccccccTTTTcHHHHHHHHHTTcGGGHHHHHHHTcHHHHHHHHHHHHcccEEEEEcTTccEcHHEEEEEccHHHHHHHHHHHHTTTTTGGGcTTccTTHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHGGHHHHTccccccccccGGGcccccEEEEcccTTccccGGGcccEEEEcTTccEEEEEEEEEEEcTTccTTTTcEEEEEEEETTEETEEEEEEcccTEcccTHTcTTTcccccEEEEEEccccccTTccEEEEEEEEEEEEEEccTTcHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccccTccccTTcTTEEGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGGGcTTcHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHHcTTHHHHHHHHHHTTTTccHHHHHHHHHHHHHTTcccGGGHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHGGGcccHHHHcHHHHHHHHHHTTcTHHHHHHTTcccHHHHHHHHH### DISOP:02AL 1-1| PSIPRED cccccccHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccEEEEEEcccccccccHHccEEEEEEcccccEEEEEEEEEEccccccccccEEEEEEEEccccccccccEEEEEEEcccccccccccccccEEEcccccccccccccEEEEEEccHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //