[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07275.1
DDBJ      :             Enoyl-CoA hydratase
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  659/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->246 3fduA PDBj 4e-30 33.8 %
:RPS:PDB   3->254 2ej5A PDBj 5e-45 33.3 %
:RPS:SCOP  3->254 1hzdA  c.14.1.3 * 2e-45 22.7 %
:HMM:SCOP  3->254 2fw2A1 c.14.1.3 * 1.7e-71 38.6 %
:RPS:PFM   13->181 PF00378 * ECH 1e-22 36.7 %
:HMM:PFM   14->180 PF00378 * ECH 7.5e-46 37.7 167/170  
:BLT:SWISS 3->252 PECI_RAT 5e-30 34.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07275.1 GT:GENE ABF07275.1 GT:PRODUCT Enoyl-CoA hydratase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 417104..417880 GB:FROM 417104 GB:TO 417880 GB:DIRECTION + GB:PRODUCT Enoyl-CoA hydratase GB:PROTEIN_ID ABF07275.1 GB:DB_XREF GI:93353186 InterPro:IPR001753 LENGTH 258 SQ:AASEQ MSIATSIDQGVLTIGFDRIDKKNAITAAMYQTMADALRAAETDAAVRVIVIEGKPEVFTAGNDIEDFLKRPPTNGADGAPAPVFQFLQAISRATKPIVASVSGAAVGIGTTLLLHCDLVYASETAKLALPFAQLGLCPEAASSLLLPRMVGYQRAAEKLLLGEAFSAQEAFEIGLVTKVLSVAELQGYVRQQAAKLAVLPASSLRETKRLMKGDDAAAVEKKMLEEGEVFRRMLVAPEAKEAFTAFFEKRKPDFSKFS GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 3->252|PECI_RAT|5e-30|34.3|248/391| SEG 34->45|adalraaetdaa| BL:PDB:NREP 1 BL:PDB:REP 6->246|3fduA|4e-30|33.8|237/248| RP:PDB:NREP 1 RP:PDB:REP 3->254|2ej5A|5e-45|33.3|243/250| RP:PFM:NREP 1 RP:PFM:REP 13->181|PF00378|1e-22|36.7|169/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 14->180|PF00378|7.5e-46|37.7|167/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 3->254|1hzdA|2e-45|22.7|251/266|c.14.1.3| HM:SCP:REP 3->254|2fw2A1|1.7e-71|38.6|251/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4965 OP:NHOMOORG 871 OP:PATTERN 33-1--5887988976-121211952222328-----------------------------2331-11 2544A214113533HSHCC-CK33KYBBBBBHSPWPFOhj1P3N212511125554341198L17CEC7A7--------1519-----1111-1211--31232254322--------------11111121111144444---3811121111111111111111-112111111111111133422---6545555544646464443855446645A965411111119-111111111111111111111-1----1-----11---1-111111---111111111111111111111111111111111-1111111--1231111111212-2221221-2-1-3-11-451427-15---1--2-5--C88E-----3-TIL424NEQHE67756675776-22622D386CR-7333448869A9788F7989478888B--------522--994-----------------------------1CGSC-4aQENBDEDLB85554AACC777637GAYMZfR23CC7A78CBHAIEJP228----64----------H7A5T991---------16862D13--44349742---------------------------651471838635565545855556575568---2-1-------32232226445643477-476753365644455655644411323454444444444444453334444--244444444444---1222221111-4634111111111112111CCAAC485665188885957487877546----------232411111352445555555555-------1774444-----------------------------------------------11 ----543-422-437C976A896B7A99A45358965A67777766586998CA6723446521111--11--11-----122122-1-6539664111-417656-984KGB9D996455694C8384T*J-MAG4354A56B72397-84296797ECFA6E871857787863232N34434668C735779765A ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 100.0 SQ:SECSTR ccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEEccccccccccccHHHHHHTccccHHHHHTHHHHHHHHHHccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEccGGGGTccccTTHHHHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcGGGHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHTTTccccccccc DISOP:02AL 254-254,256-256,258-259| PSIPRED cEEEEEEEccEEEEEEccHHHHccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccc //