[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07280.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  579/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   68->182 3dhwA PDBj 3e-05 36.1 %
:RPS:PDB   32->156 2c3yB PDBj 4e-05 21.6 %
:RPS:SCOP  65->259 2r6gG1  f.58.1.1 * 8e-11 12.3 %
:HMM:PFM   83->241 PF00528 * BPD_transp_1 1.1e-24 25.2 159/185  
:HMM:PFM   67->96 PF11382 * DUF3186 9.7e-05 33.3 30/308  
:BLT:SWISS 75->258 Y4188_BRUSU 3e-25 29.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07280.1 GT:GENE ABF07280.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 422426..423205 GB:FROM 422426 GB:TO 423205 GB:DIRECTION + GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABF07280.1 GB:DB_XREF GI:93353191 InterPro:IPR000515 LENGTH 259 SQ:AASEQ MIMNTMSSIQAKRVQRVAPWLLLGAFLLLWQVACLAFNVSDFILPSPSSIVASMAEYGDVIAAHAWRTFWTTMVGFGLAIAVGVVLGMLMGSSKLAYAATYPLMTAFNALPKAAFVPILVVWFGLGAGPAILTAFLISFFPIMVNIATGLATLEPELEDVLRVLGAKRRDVLLKVGLPRAMPFFFASLKVAITLAFVGTTVSEMNAANEGIGYLLVSAGSAMKMPLAFAGLVVIAIMAMGMYELFSVLEKRMTGWAHRG GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 75->258|Y4188_BRUSU|3e-25|29.9|184/250| TM:NTM 6 TM:REGION 24->46| TM:REGION 67->89| TM:REGION 103->125| TM:REGION 137->159| TM:REGION 182->204| TM:REGION 217->239| SEG 21->29|lllgaflll| BL:PDB:NREP 1 BL:PDB:REP 68->182|3dhwA|3e-05|36.1|108/203| RP:PDB:NREP 1 RP:PDB:REP 32->156|2c3yB|4e-05|21.6|125/1230| HM:PFM:NREP 2 HM:PFM:REP 83->241|PF00528|1.1e-24|25.2|159/185|BPD_transp_1| HM:PFM:REP 67->96|PF11382|9.7e-05|33.3|30/308|DUF3186| RP:SCP:NREP 1 RP:SCP:REP 65->259|2r6gG1|8e-11|12.3|195/284|f.58.1.1| OP:NHOMO 2083 OP:NHOMOORG 606 OP:PATTERN ----1----------------1----------11-21121222232--121141------2-----11 -1--71--112-1-433----2---C------344479B5-8-5431--12-615121--11--5335243122211111-23----1--11-211---------1----1111111111111111---1-----123333---34213222334332-1--1331342121------------11---1-113444444554444445713314443313232-1111112D122222222222222133-11-11221----11--331-2-1----111---113311111111111-------------111---111-1134A1112332222358821113341-31---87151-2--42111-11--2111------54HIR-36B24B27776767676D-CACA9AB98E11NCCA86AB99BAKB1-1B6A788964422222222212-2312--------------------------------1-16FDC339978333332667833332395P9688-3662266226664GF141-61331-------1--13322713221211--2117--2-31-222227141211----------------1------3121111-2-3------1--------------1-2-1------5465-443333333333-333333332333333333468677111111111111111111152233233--344444424444--------------23221-1--1-111-1--13333314--18276668797289685866---------11221-----333111-21-11----------3-------------------------------------------13-12-222-12 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------2--3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 68.7 SQ:SECSTR ###############################HHHHHHHHccEEEEcccTTTHHHHHHHHHHHHHTcccTTccccEEcHHHHHHHHHHHHTTccEEEEEcHHHHHHHHHHHHHHHHTTccEEEEEEccccccccccccccHHHHHTTTcccEEEEccTTTHHHHHTccTHHHHHHTTHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTc################################################## DISOP:02AL 1-10,259-260| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //