[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07321.1
DDBJ      :             aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  273/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:348 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->313 3csvA PDBj 1e-25 35.1 %
:RPS:PDB   59->277 1avqA PDBj 2e-41 10.0 %
:RPS:SCOP  195->335 1zylA1  d.144.1.6 * 1e-09 17.6 %
:HMM:SCOP  1->282 1j7lA_ d.144.1.6 * 8.3e-31 22.1 %
:RPS:PFM   46->237 PF01636 * APH 1e-06 29.0 %
:HMM:PFM   37->260 PF01636 * APH 1.7e-33 28.0 214/238  
:BLT:SWISS 100->235 IIGP5_BOVIN 3e-04 32.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07321.1 GT:GENE ABF07321.1 GT:PRODUCT aminoglycoside phosphotransferase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(459542..460588) GB:FROM 459542 GB:TO 460588 GB:DIRECTION - GB:PRODUCT aminoglycoside phosphotransferase GB:PROTEIN_ID ABF07321.1 GB:DB_XREF GI:93353232 InterPro:IPR002575 LENGTH 348 SQ:AASEQ MSALLHAPGQDPRIEQLKTWVARLGAAWSIDPDSCAPASADASFRRYFRVRTGHPAHPTAIVMDAPPSHEDCRPFIHVAKLFGDAGVTVPTVLAQDLDQGFLLLADLGSQTYLSRLDDTSAHNLYTDAAAALVKIQAATRPGELPAYDRALLQRELDLFPQWYIAKHLGVTLDDRQQADLREVFETILTNNLAQPQVYVHRDYHSRNLMVLPEAGNPGVLDFQDAVIGPITYDAVSLWRDAYIEWEEEQQLDWLIRYWERARKTGLPVAADFGEFYRDFEWMGLQRHLKVLGIFARLYHRDGKDGYLANLPLVLRYTRNVAGRYSEMRKLVRLLDAIEGTERPTGFTF GT:EXON 1|1-348:0| BL:SWS:NREP 1 BL:SWS:REP 100->235|IIGP5_BOVIN|3e-04|32.3|127/465| SEG 29->43|sidpdscapasadas| BL:PDB:NREP 1 BL:PDB:REP 46->313|3csvA|1e-25|35.1|251/316| RP:PDB:NREP 1 RP:PDB:REP 59->277|1avqA|2e-41|10.0|209/228| RP:PFM:NREP 1 RP:PFM:REP 46->237|PF01636|1e-06|29.0|186/221|APH| HM:PFM:NREP 1 HM:PFM:REP 37->260|PF01636|1.7e-33|28.0|214/238|APH| RP:SCP:NREP 1 RP:SCP:REP 195->335|1zylA1|1e-09|17.6|125/325|d.144.1.6| HM:SCP:REP 1->282|1j7lA_|8.3e-31|22.1|253/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 273 OP:NHOMOORG 273 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------1--1-------------------------------111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--1-111111111111111111111111-11111111111-111111111111111111-11111111------------11-1-----------------------------11111-1111111111111111111111111111111111111111111111111111111111111111111111111-11-------------------11111111--------------------1---111111-11-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111---------1--------------111111111111111-1-111111------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 297 STR:RPRED 85.3 SQ:SECSTR #############################################ccEEEEc##TTHHHHHcccGGGccTTcHHHHHTTTcEETTTGGGTTccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEccccEEccTTccEccEEETTccEEEEEccccHHHHHHHHHHHHHHcGGGccHHHHHHHHHHHHHHTTcccEEEEEEEcTTcccccEEEEEEEccHHHHHHHHHHHHHcEEcHHHHHHHHHHTTccTTGGGcHcGGGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccGGGHHHHHHHHHHcccccHHH#### DISOP:02AL 1-7,342-345| PSIPRED cccccccccccHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEccccccccEEEEEccccccccHHHHHHHHHHHHccccccEEHHccccccEEEEEccccccHHHHcccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccEEEEcccccEEEEEEccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccccccc //