[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07325.1
DDBJ      :             dimethyladenosine transferase
Swiss-Prot:KSGA_RALME   RecName: Full=Dimethyladenosine transferase;         EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase;

Homologs  Archaea  56/68 : Bacteria  878/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->265 1qyrA PDBj 3e-58 48.8 %
:RPS:PDB   9->193 3bt7A PDBj 4e-13 8.7 %
:RPS:SCOP  17->267 1qyrA  c.66.1.24 * 9e-60 48.4 %
:HMM:SCOP  2->268 1i4wA_ c.66.1.24 * 1.3e-79 44.9 %
:RPS:PFM   10->264 PF00398 * RrnaAD 2e-49 49.2 %
:HMM:PFM   11->236 PF00398 * RrnaAD 4.7e-55 35.3 218/262  
:BLT:SWISS 1->278 KSGA_RALME e-150 100.0 %
:PROS 41->68|PS01131|RRNA_A_DIMETH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07325.1 GT:GENE ABF07325.1 GT:PRODUCT dimethyladenosine transferase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 465833..466669 GB:FROM 465833 GB:TO 466669 GB:DIRECTION + GB:PRODUCT dimethyladenosine transferase GB:PROTEIN_ID ABF07325.1 GB:DB_XREF GI:93353236 InterPro:IPR000051 InterPro:IPR001737 InterPro:IPR011530 LENGTH 278 SQ:AASEQ MRSNVHQGHVARKRFGQNFLVDDGIIHGIVSAIDPQPNDIVVEIGPGLGALTDPLLERLPGMQVVELDRDLVERLRRRYGDRLVVHAGDALAFDFGKLREPGRALRIVGNLPYNISSPLLFHLVDFADDVRDQHFMLQKEVVERMVADPGSKSYGRLSIMLQVRYHMEHVLDVPPASFNPPPKVDSAVVRMIPWPRAEDGTLRSPYAACDAGVLGDVVTAAFSQRRKVLRNTLSFLRDQVDFDALGFDLTRRAEEVPVAEYVELARIVGGAEPPARVA GT:EXON 1|1-278:0| SW:ID KSGA_RALME SW:DE RecName: Full=Dimethyladenosine transferase; EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase; SW:GN Name=ksgA; OrderedLocusNames=Rmet_0439; SW:KW Antibiotic resistance; Complete proteome; Methyltransferase;RNA-binding; rRNA processing; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->278|KSGA_RALME|e-150|100.0|278/278| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 41->68|PS01131|RRNA_A_DIMETH|PDOC00871| SEG 64->78|vveldrdlverlrrr| BL:PDB:NREP 1 BL:PDB:REP 17->265|1qyrA|3e-58|48.8|242/252| RP:PDB:NREP 1 RP:PDB:REP 9->193|3bt7A|4e-13|8.7|184/369| RP:PFM:NREP 1 RP:PFM:REP 10->264|PF00398|2e-49|49.2|246/256|RrnaAD| HM:PFM:NREP 1 HM:PFM:REP 11->236|PF00398|4.7e-55|35.3|218/262|RrnaAD| GO:PFM:NREP 3 GO:PFM GO:0000154|"GO:rRNA modification"|PF00398|IPR001737| GO:PFM GO:0000179|"GO:rRNA (adenine-N6,N6-)-dimethyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF00398|IPR001737| RP:SCP:NREP 1 RP:SCP:REP 17->267|1qyrA|9e-60|48.4|244/252|c.66.1.24| HM:SCP:REP 2->268|1i4wA_|1.3e-79|44.9|256/0|c.66.1.24|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1239 OP:NHOMOORG 1119 OP:PATTERN 111111----------1111111111111111111111111111111111111111111111111--1 1111111111111111111-1111111111111111111111-1-11111111111-111111111111-11111111111111111111111111-1111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-----1---------1111-111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-11--1--1111111111111-1111111111111-1-111111111-111111 22-1211-411122111111111111111-11111111111111111111--1-11-11111111111111111111-1111111111-1211111111111122212-2432223-122112222-21272-2222-12211311221221232222211221221423142222122F2222232321322222222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 96.0 SQ:SECSTR ####EETTEEETTccccccHHHHHHHHHHHHHHTTTcccEEEEEccTTcHHHHHHGGGccEEEEEcccHHHHHHHHHHHHHHTTcccEEEEccccHHHHHHHccccccTTGGGccGGGccEEEEEEcccTTcccHHHHHHHTTccEEEEEEccHHHHHHHHHHHHHHEEEEEEEEEcccTTccccEEEEEEEEcccEEEETEEEEEEEEEEccccEEEEEEccccHHHHHHHHHHHHTTcEEEEEEETTEETTccccccEEEEEEEHTTTc####### DISOP:02AL 1-8,271-279| PSIPRED ccccHHccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccEEEEEEEcHHHHHHHHHHcccccEEEEccEEEccHHHHccccccEEEEEEcccHHHHHHHHHHHcccccccEEEEEEEHHHHHHHHcccccccHHHHHHHHHHHEEEEEEEEEcHHHcccccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHcccccccccEEccHHHHHHHHHHHHccccccccc //