[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07338.1
DDBJ      :             PhoH-like protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  783/915 : Eukaryota  5/199 : Viruses  7/175   --->[See Alignment]
c.37.1d.194.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   119->322 3b85A PDBj 7e-47 60.9 %
:RPS:PDB   14->276 3e1sA PDBj 4e-23 18.3 %
:RPS:SCOP  13->193 1t8hA  d.194.1.2 * 4e-18 14.7 %
:RPS:SCOP  207->321 1w36B1  c.37.1.19 * 7e-10 15.7 %
:HMM:SCOP  119->297 1w36D1 c.37.1.19 * 1.4e-41 30.7 %
:RPS:PFM   118->320 PF02562 * PhoH 4e-83 72.9 %
:HMM:PFM   120->322 PF02562 * PhoH 2.9e-95 64.5 203/205  
:BLT:SWISS 1->324 PHOL_SHIFL 3e-94 57.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07338.1 GT:GENE ABF07338.1 GT:PRODUCT PhoH-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(479321..480316) GB:FROM 479321 GB:TO 480316 GB:DIRECTION - GB:PRODUCT PhoH-like protein GB:PROTEIN_ID ABF07338.1 GB:DB_XREF GI:93353249 InterPro:IPR003714 LENGTH 331 SQ:AASEQ MKIPTAEFVAPRDDNTRLQNLCGPLDENLRQIEQALDVTIQRRGHRMTVRGERAQDATLALERFYNNARVALSIDDVQLGLVESRQVAAHGAYLPSTEGNDGSSIDDESPVLHTRRTGLQGRTAMQRDYLRNILSHDLTLGVGPAGTGKTYLAVACAVDALERDVVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDRTQKMFERQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVITGDTTQIDLPRGQKSGLVEAQHVLRDVRGVSLTRFTSVDVVRHPLVARIVEAYDEYHAQHKDA GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 1->324|PHOL_SHIFL|3e-94|57.5|315/346| BL:PDB:NREP 1 BL:PDB:REP 119->322|3b85A|7e-47|60.9|179/180| RP:PDB:NREP 1 RP:PDB:REP 14->276|3e1sA|4e-23|18.3|229/517| RP:PFM:NREP 1 RP:PFM:REP 118->320|PF02562|4e-83|72.9|203/205|PhoH| HM:PFM:NREP 1 HM:PFM:REP 120->322|PF02562|2.9e-95|64.5|203/205|PhoH| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02562|IPR003714| RP:SCP:NREP 2 RP:SCP:REP 13->193|1t8hA|4e-18|14.7|163/272|d.194.1.2| RP:SCP:REP 207->321|1w36B1|7e-10|15.7|115/469|c.37.1.19| HM:SCP:REP 119->297|1w36D1|1.4e-41|30.7|163/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1195 OP:NHOMOORG 808 OP:PATTERN 111111----------11111-1------------------------------1-------------- 1111221222221122222-22222222222122222222222222222222222223--1122222222211111111-111111112221-2221--1111111211211111111111111111111111111----------231111111222121112111111111112111211211111112122222222222222222222222222122112211111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122--1111111-1-111111111-21111121221221211111211--111222211111111111111111111111111111-22222222111-1111111111111122311111111111111111111111222-----------------------------111111222222222222222222222222222222222-122223222222222222222222111111111222212221222122222-111111121222222112-----------1--------1---22222221222212222222222222222222--12222------22221222222222212-2222222222222222222222222222222112111232222222121121-22222211222211-211111222222222111111-----11111111111111222222222222222222211111111121112222222222222222222222111--12111111--------1-1-------------------------222222222212- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------1-----------1------1-----------1---- -----1-1-----------1---11------------------------------------------1--------------------------------------------------------------------------------------------1-------------- STR:NPRED 296 STR:RPRED 89.4 SQ:SECSTR #############HHHHTccccEEHHHHHHHHHHHHcccHHHHHHHHHHHHHHTc#####cEEEcc##ccccccccccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccTTTTTTccHHHHHHHHHHTTccEEEEEccTTccHHHHHHHHHHHHHHHHTTccEEEEEccHHHHHHHHHHHTccEEEHHHHTccccHHHHHHHHHHHHHHTHHTTcETEETTEEccccccccccEEEccGGGccHHHHHHHHTTccTTcEEEEEEcTTccc######cccHHHHHHTTTcTTEEEEEccGGGccccHHHHHHHHHHc######### DISOP:02AL 1-2,93-107,322-332| PSIPRED ccccEEEEEEccccHHHHHHHHHcccHHHHHHHHHcccEEEEcccEEEEEEcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHccccHHHHHccccccccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEEEcccccccccccEEEEEccccccHHHHHHHHHHcccccEEEEccccHHEEcccccccHHHHHHHHHcccccEEEEEEEccccEEHHHHHHHHHHHHHHHcccccc //