[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07343.1
DDBJ      :             aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  221/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:348 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->346 1zylA PDBj 1e-73 46.5 %
:RPS:PDB   23->346 3dxqA PDBj 8e-16 14.8 %
:RPS:SCOP  14->346 1zylA1  d.144.1.6 * 7e-34 44.9 %
:HMM:SCOP  22->297 1nd4A_ d.144.1.6 * 3.7e-20 26.2 %
:HMM:PFM   43->280 PF01636 * APH 3.4e-33 23.4 209/238  
:BLT:SWISS 18->346 RDOA_ECOLI 3e-73 46.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07343.1 GT:GENE ABF07343.1 GT:PRODUCT aminoglycoside phosphotransferase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 485852..486898 GB:FROM 485852 GB:TO 486898 GB:DIRECTION + GB:PRODUCT aminoglycoside phosphotransferase GB:PROTEIN_ID ABF07343.1 GB:DB_XREF GI:93353254 InterPro:IPR002575 LENGTH 348 SQ:AASEQ MSEPDRPSSTDEVPYAGLTPECILDALEAAGFYPDGRLLALNSYENRVWQVGIEDAAPVVAKFYRPGRWTDAAILEEHAFVQQLAGAEVPAVPALAANSGDQSGTTLFTHEGFRFAVFPRCGGREPALDKAETRTWLGRFIGRIHAIGATAPYQARPALDIDTFGIASRDYLLAHDCIPADLLAPWRAAADLALDGVRRSYERAGEVRLLRLHGDCHRGNVLWIDEEDARGRGTPGPHFVDFDDSRMGPAVQDLWMLLEGDRVAMQDQLADIVAGYEDFAEFDARELWLVEALRTLRLLHYSAWLASRWRDPAFPAAFPWFGTARYWQDRILELREQIALMDEAPLWA GT:EXON 1|1-348:0| BL:SWS:NREP 1 BL:SWS:REP 18->346|RDOA_ECOLI|3e-73|46.5|312/328| BL:PDB:NREP 1 BL:PDB:REP 18->346|1zylA|1e-73|46.5|312/325| RP:PDB:NREP 1 RP:PDB:REP 23->346|3dxqA|8e-16|14.8|271/282| HM:PFM:NREP 1 HM:PFM:REP 43->280|PF01636|3.4e-33|23.4|209/238|APH| RP:SCP:NREP 1 RP:SCP:REP 14->346|1zylA1|7e-34|44.9|316/325|d.144.1.6| HM:SCP:REP 22->297|1nd4A_|3.7e-20|26.2|248/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 223 OP:NHOMOORG 223 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111--1111111111111111-11-11----------111-1---1----------11111-111-----1-----------------------------111111111111111111111111111111----111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1----------1111-------------------------1111111111111111111----------11111111111111----------------1-111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 325 STR:RPRED 93.4 SQ:SECSTR #################HHHHHHHHHTTTcTTTTccccEEEEcccEEEEEETcccccTEEEEEEcccHHHHHHHHHHHHHHHHHHTTccccEEEEcTTTc###TccEEEcTTEEEEcTTcEEcHHHHHHcTTHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHcccHHHccccccTTHHHHHHHHHHHHHHHHTccccccEEEcccccGGGEEEcccccGGGG#cccccEEcccTTcEEcTHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcTTccHHHHHHHHHHHHHHHHHHHcHHHHHHH## DISOP:02AL 1-13,348-349| PSIPRED cccccccccccccccccccHHHHHHHHHHccccccccEEEEccccccEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccEEEEHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccc //