[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07347.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->70 PF02124 * Marek_A 0.00075 20.5 39/211  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07347.1 GT:GENE ABF07347.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(490136..490390) GB:FROM 490136 GB:TO 490390 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF07347.1 GB:DB_XREF GI:93353258 LENGTH 84 SQ:AASEQ MFRIVALGNLRARAMPRGSPLTSGSQAKQVATRITSKAAAHPPQATAELPWRRYQNEAKRFWLDARPQTVQVARQGCATTPESC GT:EXON 1|1-84:0| HM:PFM:NREP 1 HM:PFM:REP 32->70|PF02124|0.00075|20.5|39/211|Marek_A| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 19-29,80-85| PSIPRED cEEEEEEcccHHHcccccccccccHHHHHHHHHHHHHHccccccccccccHHHHccHHHHEEEccccHHHHHHHHccccccccc //