[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07356.1
DDBJ      :             succinyl-CoA synthetase (ADP-forming) alpha subunit
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  672/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.23.4
:293 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->286 2fpgA PDBj 1e-65 50.0 %
:RPS:PDB   2->292 1cqjA PDBj 2e-50 53.5 %
:RPS:SCOP  2->127 1cqiA1  c.2.1.8 * 3e-16 42.1 %
:RPS:SCOP  128->291 1cqiA2  c.23.4.1 * 2e-50 62.2 %
:HMM:SCOP  1->127 1eucA1 c.2.1.8 * 6e-42 46.3 %
:HMM:SCOP  128->294 1oi7A2 c.23.4.1 * 5.3e-61 41.9 %
:RPS:PFM   9->102 PF02629 * CoA_binding 2e-07 40.7 %
:RPS:PFM   156->276 PF00549 * Ligase_CoA 6e-16 46.3 %
:HMM:PFM   6->102 PF02629 * CoA_binding 2.1e-26 40.6 96/96  
:HMM:PFM   156->271 PF00549 * Ligase_CoA 3.7e-18 30.2 116/153  
:HMM:PFM   89->124 PF10087 * DUF2325 0.0009 27.8 36/98  
:BLT:SWISS 1->293 SUCD_BACSU 2e-90 56.9 %
:PROS 241->254|PS00399|SUCCINYL_COA_LIG_2
:PROS 157->186|PS01216|SUCCINYL_COA_LIG_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07356.1 GT:GENE ABF07356.1 GT:PRODUCT succinyl-CoA synthetase (ADP-forming) alpha subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 499606..500487 GB:FROM 499606 GB:TO 500487 GB:DIRECTION + GB:PRODUCT succinyl-CoA synthetase (ADP-forming) alpha subunit GB:PROTEIN_ID ABF07356.1 GB:DB_XREF GI:93353267 InterPro:IPR003781 InterPro:IPR005810 InterPro:IPR005811 LENGTH 293 SQ:AASEQ MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNCFVAGVNPKKAGEDFEGIPIYASVKDAKEQTGATVSVIYVPPAGAAAAIWEAVDADLDLVVCITEGIPVRDMMEVKDKMRRQNKKTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGVVSRSGTLTYEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGPDEANAAYWIKENMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAQAKLEIMEACGIKVTKNPSEMGRLLKAML GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 1->293|SUCD_BACSU|2e-90|56.9|288/300| PROS 241->254|PS00399|SUCCINYL_COA_LIG_2|PDOC00335| PROS 157->186|PS01216|SUCCINYL_COA_LIG_1|PDOC00335| SEG 79->91|agaaaaiweavda| BL:PDB:NREP 1 BL:PDB:REP 3->286|2fpgA|1e-65|50.0|280/305| RP:PDB:NREP 1 RP:PDB:REP 2->292|1cqjA|2e-50|53.5|286/286| RP:PFM:NREP 2 RP:PFM:REP 9->102|PF02629|2e-07|40.7|91/95|CoA_binding| RP:PFM:REP 156->276|PF00549|6e-16|46.3|121/127|Ligase_CoA| HM:PFM:NREP 3 HM:PFM:REP 6->102|PF02629|2.1e-26|40.6|96/96|CoA_binding| HM:PFM:REP 156->271|PF00549|3.7e-18|30.2|116/153|Ligase_CoA| HM:PFM:REP 89->124|PF10087|0.0009|27.8|36/98|DUF2325| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00549|IPR005811| GO:PFM GO:0008152|"GO:metabolic process"|PF00549|IPR005811| RP:SCP:NREP 2 RP:SCP:REP 2->127|1cqiA1|3e-16|42.1|121/121|c.2.1.8| RP:SCP:REP 128->291|1cqiA2|2e-50|62.2|164/165|c.23.4.1| HM:SCP:REP 1->127|1eucA1|6e-42|46.3|123/0|c.2.1.8|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 128->294|1oi7A2|5.3e-61|41.9|167/0|c.23.4.1|1/1|Succinyl-CoA synthetase domains| OP:NHOMO 1293 OP:NHOMOORG 919 OP:PATTERN 111111111111111111111112111111111111111111111111-----1-------1111-11 111111-1111---11111-11111111111111111111111111111111111111--111111122111111111----122222111------11111111111111111111111111112222222222211111---11-11-111----------11--1111------------11111---1111111111111111111111111111111111------1111111111111111111111-----------------------------------------------------------------------11-------------------------1--1-33--2--111-------1-1111111111121111131111211111111111-332222221211111111211111121112111111312--------111-2111111111111111111111111111111111111111111111111111111111411111111111121111122111111121111111111111111122211111121111-11111-32314141111211122--11111111----------21222111111111111111111111111111111111111111------21111112223233322-22222332222321212231111111111111111111111111111111211111111111111111111111111121111111111-111-11111111111111111111111111111111111111111111111111111111111111111111111112-111111------------------------------------1---1-1---111 11--212-421-2222232222232222222222231222222222222233231122222221111111111111111111111112-24222222222223323-22144933231122222441116K3-3142212211342222222242322343722222523344322121H1112261473432132223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 100.0 SQ:SECSTR ccccccTTcEEEEETTTcHHHHHHHHHHHHHTcEEccEEEEEcTTcTTEEETTEEEEccHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHTccEEEEccccccHHHHHHHHHHHHHTTcETEEEcccccEEEETTTEEEEcccGGGccEEEEEEEEccHHHHHHHHHHHHHTcccEEEEEEccccccccccHHHHHHHHHTcTTccEEEEEEEccccHHHHHHHHHHHHccccEEEEEEcTTccTTcccccTTccccTTcccHHHHHHHHHHTccEEcccGGGHHHHHTTcc PSIPRED ccEEEccccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEcccccccEEccEEccccHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEcccEEEEcccccccccccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccEEcccHHHHHHHHHHHc //