[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07369.1
DDBJ      :             Integrase, catalytic region
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.14a.4.5
:508 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->40 1bibA PDBj 2e-06 11.1 %
:RPS:PDB   11->92 3by6B PDBj 1e-05 23.2 %
:RPS:SCOP  2->40 1qbjA  a.4.5.19 * 4e-05 15.4 %
:RPS:SCOP  22->87 1vz0A1  a.4.14.1 * 8e-06 29.2 %
:RPS:PFM   15->39 PF02796 * HTH_7 8e-04 60.0 %
:HMM:PFM   131->254 PF00665 * rve 4.1e-13 19.8 111/120  
:HMM:PFM   18->41 PF09339 * HTH_IclR 7.4e-07 45.8 24/52  
:HMM:PFM   81->117 PF11740 * KfrA_N 0.00058 30.3 33/120  
:BLT:SWISS 4->508 TRAT_CHEHE 0.0 61.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07369.1 GT:GENE ABF07369.1 GT:PRODUCT Integrase, catalytic region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 511185..512711 GB:FROM 511185 GB:TO 512711 GB:DIRECTION + GB:PRODUCT Integrase, catalytic region GB:PROTEIN_ID ABF07369.1 GB:DB_XREF GI:93353280 InterPro:IPR001584 InterPro:IPR007101 LENGTH 508 SQ:AASEQ MIDVAILSIIRRWHLRDQIPLREIARRLGISRNTVRRYLRTDVTAPAYPTRQSPSKLDGHAAKLAAWLKTEANKPRKQRRTLKQIHADLCALGFTGSYDRVAAFARRWRQEQQEQARSSGRGTYIPLRFAEGEAFQFDWSEDWAVIAGERTKLQVAQFKLSHSRAFFLRAYLLQTHEMLFDAHHHAFVAWGGIPRRGIYDNMKTAVDRVRQGKLRDVNLRFGTMVSHYLFDAEFCNPASGWEKGQIEKNVQDSRHRIWQRVPAFGSLAALNDWLADQCVRLWQQTRHPELDMTIWEAWSLERPHLMPVGQAFDGFVEHTKRVSPTCLVNFERNRYSVPASFANRPISLRVYATRLLFVAEGQVIAEHVRHINRGHHPGHTVYDWRHYLAVLQRKPGALRNGAPFAELPEGFRRLQATLLKRPGGDREMVEILALVLLHDEQAVLTAVELALEAGAASKQTVLNILSRLLEGGPVAPITTPQALALQVEPQANVARYDSLRDREVPHAA GT:EXON 1|1-508:0| BL:SWS:NREP 1 BL:SWS:REP 4->508|TRAT_CHEHE|0.0|61.4|505/508| SEG 102->117|aafarrwrqeqqeqar| SEG 442->456|avltavelaleagaa| RP:PDB:NREP 2 RP:PDB:REP 2->40|1bibA|2e-06|11.1|36/294| RP:PDB:REP 11->92|3by6B|1e-05|23.2|82/118| RP:PFM:NREP 1 RP:PFM:REP 15->39|PF02796|8e-04|60.0|25/44|HTH_7| HM:PFM:NREP 3 HM:PFM:REP 131->254|PF00665|4.1e-13|19.8|111/120|rve| HM:PFM:REP 18->41|PF09339|7.4e-07|45.8|24/52|HTH_IclR| HM:PFM:REP 81->117|PF11740|0.00058|30.3|33/120|KfrA_N| GO:PFM:NREP 3 GO:PFM GO:0000150|"GO:recombinase activity"|PF02796|IPR006120| GO:PFM GO:0003677|"GO:DNA binding"|PF02796|IPR006120| GO:PFM GO:0006310|"GO:DNA recombination"|PF02796|IPR006120| RP:SCP:NREP 2 RP:SCP:REP 2->40|1qbjA|4e-05|15.4|39/65|a.4.5.19| RP:SCP:REP 22->87|1vz0A1|8e-06|29.2|65/93|a.4.14.1| OP:NHOMO 372 OP:NHOMOORG 117 OP:PATTERN --------------------------------------------------J----------------- --2----1------------------------1--1--1---------------2-------------11-3----A----1---------1-6-----------------------------------1--------------------------------------------------------------------------1---6-1--------12---------------------------------------------22----------7--------------------------------------------5-1-1--------------------7--4----11-115-------8------5----------2-1611-2-------------1-139---1--1---1142-----4----------3-----222222222A5------------------------------------1E4-----1-44---A-------1-----1-42---3--2-4-3-5--11-2--36----------------2----3--3-2---------3A821-4----11-2----------------------------------------------------------------------------------1--8------1---------------------------------------------M---1-111-11-1-----------3-1----------------------------------1----------2-4-----------------------------------------1--------------------------------------------C1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 19.5 SQ:SECSTR HHHHHHHHHHTTccTcccccHHHHHHHHTccHHHHHHHHHEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHEcccccc######################################################################################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 45-58,107-124,471-478,501-509| PSIPRED cccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEccccEEEccEEEEEEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHccccccEEEEccccEEEEEEcccccccccHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccEEEEEEEcccEEEEEccEEEEccHHHcccEEEEEEEccEEEEEEccEEEEEEEEcccccccccccEEcHHHHHHHHHHcHHHHHcccHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccc //