[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07378.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->56 2jz8A PDBj 3e-06 41.3 %
:RPS:PFM   30->52 PF10276 * zf-CHCC 6e-05 69.6 %
:HMM:PFM   23->52 PF10276 * zf-CHCC 7.8e-11 32.1 28/40  
:BLT:SWISS 33->56 RPOP_THEON 7e-04 58.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07378.1 GT:GENE ABF07378.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(519718..519912) GB:FROM 519718 GB:TO 519912 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF07378.1 GB:DB_XREF GI:93353289 LENGTH 64 SQ:AASEQ MTQTASVVEIGAEDMPLHCPTANTPAWNYHPRVFLDVADTGEVRCPYCGTVYKLKPGTVLKGHH GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 33->56|RPOP_THEON|7e-04|58.3|24/100| BL:PDB:NREP 1 BL:PDB:REP 7->56|2jz8A|3e-06|41.3|46/87| RP:PFM:NREP 1 RP:PFM:REP 30->52|PF10276|6e-05|69.6|23/40|zf-CHCC| HM:PFM:NREP 1 HM:PFM:REP 23->52|PF10276|7.8e-11|32.1|28/40|zf-CHCC| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111111111111111111111111-------111111---------------------------------------------------------11---------------------------------1111--------------------------------------------------------------------------------------------1-------------------------------------------------------------------1--------------1------1111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 71.9 SQ:SECSTR ######EEEccccEEE##cccccccc##cccccEEEcTTccEEccTTTccEEEccT######## DISOP:02AL 1-4,57-65| PSIPRED ccccccEEEEcHHHcEEEccccccHHHHcccEEEEEEccccEEEccccccEEEEcccccccccc //