[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07391.1
DDBJ      :             phosphoribosylaminoimidazole carboxylase, catalytic subunit
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  799/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
c.23.8
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->115 1xmpF PDBj 5e-30 55.5 %
:RPS:PDB   9->115 1d7aA PDBj 3e-26 47.1 %
:RPS:SCOP  7->164 1d7aA  c.23.8.1 * 8e-33 35.4 %
:HMM:SCOP  5->163 1u11A_ c.23.8.1 * 2.2e-59 55.3 %
:RPS:PFM   8->115 PF00731 * AIRC 2e-24 50.9 %
:HMM:PFM   8->157 PF00731 * AIRC 1.3e-64 58.1 148/150  
:BLT:SWISS 6->115 PUR6_BACSU 1e-30 68.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07391.1 GT:GENE ABF07391.1 GT:PRODUCT phosphoribosylaminoimidazole carboxylase, catalytic subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 535994..536491 GB:FROM 535994 GB:TO 536491 GB:DIRECTION + GB:PRODUCT phosphoribosylaminoimidazole carboxylase, catalytic subunit GB:PROTEIN_ID ABF07391.1 GB:DB_XREF GI:93353302 InterPro:IPR000031 LENGTH 165 SQ:AASEQ MSNESKPVVGVVMGSSSDWDVMQHAVAMLKDFNVPFEAQVVSAHRMADDMFRYAEAARGRGIRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSKYLRGEDSLLSIVQMPKGVPVATFAIGEAGAANAALHAIATLATTDDALASALEAFRAKQTEAARAMTLPV GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 6->115|PUR6_BACSU|1e-30|68.2|110/162| SEG 56->73|aargrgiraiiagaggaa| SEG 116->149|atfaigeagaanaalhaiatlattddalasalea| BL:PDB:NREP 1 BL:PDB:REP 6->115|1xmpF|5e-30|55.5|110/160| RP:PDB:NREP 1 RP:PDB:REP 9->115|1d7aA|3e-26|47.1|104/157| RP:PFM:NREP 1 RP:PFM:REP 8->115|PF00731|2e-24|50.9|108/148|AIRC| HM:PFM:NREP 1 HM:PFM:REP 8->157|PF00731|1.3e-64|58.1|148/150|AIRC| GO:PFM:NREP 2 GO:PFM GO:0004638|"GO:phosphoribosylaminoimidazole carboxylase activity"|PF00731|IPR000031| GO:PFM GO:0006189|"GO:'de novo' IMP biosynthetic process"|PF00731|IPR000031| RP:SCP:NREP 1 RP:SCP:REP 7->164|1d7aA|8e-33|35.4|158/161|c.23.8.1| HM:SCP:REP 5->163|1u11A_|2.2e-59|55.3|159/159|c.23.8.1|1/1|N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)| OP:NHOMO 989 OP:NHOMOORG 964 OP:PATTERN --11--1111111111-111111---------111111111111111111112111111-1111--11 1111111111111111111-111111111111111111111-111111111111111111111111111111111111111111111111111111---11111111111---------------1111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111--------11111212111111111-11-1111111---------1-111112221111111211111111111121111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--12-----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------1-11-1111111- ----111-----1111111111--1-11111--111111111111-111111111111111111111111111111111111111111-1111111111111111--12-------------------------------------------------------------------11181111111121221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 67.3 SQ:SECSTR ####cEEEcEEEEccGGGHHHHHHHHHHHHHHTccEEEEEccTTTcHHHHHHHHHTTTTTTccEEEEEEcccccHHHHHHHcccccEEEEEcccTTTTTHHHHHHHHcccTTccc################################################## DISOP:02AL 1-5,8-9,165-166| PSIPRED cccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEccccccccHHHHHHcccccEEEEcccccccccHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccc //