[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07418.1
DDBJ      :             Adenylate kinase
Swiss-Prot:KAD_RALME    RecName: Full=Adenylate kinase;         Short=AK;         EC=2.7.4.3;AltName: Full=ATP-AMP transphosphorylase;

Homologs  Archaea  25/68 : Bacteria  905/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->205 3gmtA PDBj 2e-80 76.9 %
:RPS:PDB   1->220 3dl0A PDBj 6e-69 51.9 %
:RPS:SCOP  2->173 1knqA  c.37.1.17 * 1e-21 14.6 %
:HMM:SCOP  1->188 1dekA_ c.37.1.1 * 1.6e-44 36.0 %
:RPS:PFM   5->182 PF00406 * ADK 1e-55 64.7 %
:HMM:PFM   5->185 PF00406 * ADK 1e-60 57.9 145/151  
:BLT:SWISS 1->221 KAD_RALME e-126 100.0 %
:PROS 81->92|PS00113|ADENYLATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07418.1 GT:GENE ABF07418.1 GT:PRODUCT Adenylate kinase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(567475..568140) GB:FROM 567475 GB:TO 568140 GB:DIRECTION - GB:PRODUCT Adenylate kinase GB:PROTEIN_ID ABF07418.1 GB:DB_XREF GI:93353329 InterPro:IPR000850 InterPro:IPR006259 InterPro:IPR007862 InterPro:IPR011769 LENGTH 221 SQ:AASEQ MRLILLGAPGAGKGTQAKFICEKFGIPQISTGDMLRAAVKAGTPLGIEAKKVMDAGGLVSDDIIIGLVKDRLKQPDCEKGYLFDGFPRTIPQAEAMKEAGVAIDYVLEIDVPFDAIIERMSGRRVHVASGRTYHVKFNPPKADMVDDETGEALIQRDDDKEETVRKRLDVYSQQTRPLVDYYSNWAANGDASAKVSPPKYRKIAGLGEVDKITASVFDALK GT:EXON 1|1-221:0| SW:ID KAD_RALME SW:DE RecName: Full=Adenylate kinase; Short=AK; EC=2.7.4.3;AltName: Full=ATP-AMP transphosphorylase; SW:GN Name=adk; OrderedLocusNames=Rmet_0532; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase;Nucleotide biosynthesis; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|KAD_RALME|e-126|100.0|221/221| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009165|"GO:nucleotide biosynthetic process"|Nucleotide biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 81->92|PS00113|ADENYLATE_KINASE|PDOC00104| BL:PDB:NREP 1 BL:PDB:REP 2->205|3gmtA|2e-80|76.9|199/199| RP:PDB:NREP 1 RP:PDB:REP 1->220|3dl0A|6e-69|51.9|208/216| RP:PFM:NREP 1 RP:PFM:REP 5->182|PF00406|1e-55|64.7|153/159|ADK| HM:PFM:NREP 1 HM:PFM:REP 5->185|PF00406|1e-60|57.9|145/151|ADK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00406|IPR000850| GO:PFM GO:0006139|"GO:nucleobase, nucleoside, nucleotide and nucleic acid metabolic process"|PF00406|IPR000850| GO:PFM GO:0019205|"GO:nucleobase, nucleoside, nucleotide kinase activity"|PF00406|IPR000850| RP:SCP:NREP 1 RP:SCP:REP 2->173|1knqA|1e-21|14.6|164/171|c.37.1.17| HM:SCP:REP 1->188|1dekA_|1.6e-44|36.0|186/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2118 OP:NHOMOORG 1125 OP:PATTERN --1-1-----------2------111111111----------------11111-1111111---1--- 1221111111111111111-11111111111111111122133311111111313111111111112111111111111111111111111111111--1111111111111111111111111111111111111222221112121111111111111111121122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111111111111121111111111111111111-112121111111111111221211111112112222222111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111212-11111111111111111121112111111111111111111111111111111211-1111211111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111121-11111111111111111111111111111111 2212445-F5715563232333333343322123333323333233333333432333333333333323333333334334333321-33523333233343645-456B8B87B87774877F74F4MxE-BBK4553D47953554585684679846767843737755756796*54545E9ED3BA476B777 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 100.0 SQ:SECSTR cEEEEEccTTccHHHHHHHHHHHccccEEEHHHHHHHHHHTTcHHHHHHHHHHTTTccccHHHHHHHHHHHHTcGGGTTcEEEEcccccHHHHHHHHHHTccccEEEEEEccGGGHHHHHHTEEEETTTccEEETTTcccccTTccTTTcccEEccTTccHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEEETTccTHcEEEEEccccHHHHHHHHHHHHT PSIPRED cEEEEEccccccHHHHHHHHHHHHccEEEEHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccccEEEEEEccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHHHHc //