[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07480.1
DDBJ      :             (2Fe-2S)-binding
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  379/915 : Eukaryota  130/199 : Viruses  0/175   --->[See Alignment]
a.56.1d.15.4
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->138 1ffuD PDBj 2e-27 39.0 %
:RPS:PDB   3->139 3b9jA PDBj 6e-47 42.3 %
:RPS:SCOP  1->77 1dgjA2  d.15.4.2 * 5e-21 36.4 %
:RPS:SCOP  78->139 1ffuA1  a.56.1.1 * 1e-21 40.3 %
:HMM:SCOP  1->77 1n62A2 d.15.4.2 * 4.8e-27 49.4 %
:HMM:SCOP  72->152 1dgjA1 a.56.1.1 * 1.6e-29 41.3 %
:RPS:PFM   6->51 PF00111 * Fer2 3e-07 59.1 %
:RPS:PFM   72->138 PF01799 * Fer2_2 6e-14 46.3 %
:HMM:PFM   72->145 PF01799 * Fer2_2 5.2e-29 39.2 74/75  
:HMM:PFM   5->53 PF00111 * Fer2 6.4e-12 39.6 48/77  
:BLT:SWISS 1->139 IORA_BREDI 3e-41 52.9 %
:PROS 38->46|PS00197|2FE2S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07480.1 GT:GENE ABF07480.1 GT:PRODUCT (2Fe-2S)-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 641064..641522 GB:FROM 641064 GB:TO 641522 GB:DIRECTION + GB:PRODUCT (2Fe-2S)-binding GB:PROTEIN_ID ABF07480.1 GB:DB_XREF GI:93353391 InterPro:IPR001041 InterPro:IPR002888 InterPro:IPR006058 LENGTH 152 SQ:AASEQ MTSLTINGKTVEVDADPSTPLLWALRDNLGMTGTKFGCGMASCGACTVHINGTATRSCVMPISGTAGSKITTIEAMGDDKVGRAVLAAWLKHDVAQCGYCQNGQVMSAVGLLRSKPRPTDADIDQAMAGNVCRCGTYQRIRAAIKDAAHAIA GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 1->139|IORA_BREDI|3e-41|52.9|138/152| PROS 38->46|PS00197|2FE2S_FER_1|PDOC00175| SEG 140->151|iraaikdaahai| BL:PDB:NREP 1 BL:PDB:REP 3->138|1ffuD|2e-27|39.0|136/156| RP:PDB:NREP 1 RP:PDB:REP 3->139|3b9jA|6e-47|42.3|137/162| RP:PFM:NREP 2 RP:PFM:REP 6->51|PF00111|3e-07|59.1|44/71|Fer2| RP:PFM:REP 72->138|PF01799|6e-14|46.3|67/75|Fer2_2| HM:PFM:NREP 2 HM:PFM:REP 72->145|PF01799|5.2e-29|39.2|74/75|Fer2_2| HM:PFM:REP 5->53|PF00111|6.4e-12|39.6|48/77|Fer2| GO:PFM:NREP 5 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00111|IPR001041| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00111|IPR001041| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01799|IPR002888| GO:PFM GO:0046872|"GO:metal ion binding"|PF01799|IPR002888| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01799|IPR002888| RP:SCP:NREP 2 RP:SCP:REP 1->77|1dgjA2|5e-21|36.4|77/80|d.15.4.2| RP:SCP:REP 78->139|1ffuA1|1e-21|40.3|62/76|a.56.1.1| HM:SCP:REP 1->77|1n62A2|4.8e-27|49.4|77/79|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 72->152|1dgjA1|1.6e-29|41.3|75/113|a.56.1.1|1/1|CO dehydrogenase ISP C-domain like| OP:NHOMO 1598 OP:NHOMOORG 531 OP:PATTERN 113-1-2322223323--21111-2---1--------------------------------1------ 13813---------1--11-12--5711111333331369221211---11-212-----1-9-3494531-------1---3---1--------------1-245-5----------------------------22211----5-1-111---------------1-2--------------12-------1-----1---------12---1----21-----------1--------------------1----------------------------------------------------------------------53-24444344434-4------31-21-112-311332-213-------4--4232-----24FGH41337495111111111-1-A9E88CAD562-52241184318C7523-66144445564444444453331521------------------------------2351-45445ABBBBA12221BBCC22221284GCAD4-266532311714191131-1111-----------221--3-4111121111--1113111311-133-4-------------------------221--4112-4-112222231111111--1-1----1---------1--1--2221211-21-2222111212211221221------------------------51--1111-----------------------------321---------------------1-114166662284463552433---------1---2----------1122222----------2--------------11---------------------------2222------3- ----1-1-----11-11-1111111111112111111111111-111111111111-11111-----------1------------------1-------1------242E23223822-22426D151352-324121142261-2-21B-192622226N257246AD7B345-11-7---1121261441-1-1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 91.4 SQ:SECSTR EcEEEETTEEEEETccTTccHHHHHHHTccccccccccccccccTTEEEEEEEEEETTTccGGGcTTcEEEcGGGTccTTcccHHHHHHHHTTcccccTTHHHHHHHHHHHHHHcccccHHHHHHHTTTccccccccHH############# DISOP:02AL 152-153| PSIPRED cEEEEEccEEEEEEccccccHHHHHHHHcccccccccccccccccEEEEEccEEHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHHHHHHHHHHHcc //