[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07485.1
DDBJ      :             cytochrome c oxidase, subunit II
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.6.1
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->123 2qpeB PDBj 7e-13 34.2 %
:RPS:PDB   38->124 3dtuB PDBj 5e-17 23.0 %
:RPS:SCOP  38->123 1ehkB1  b.6.1.2 * 9e-14 32.6 %
:HMM:SCOP  21->125 2cuaB_ b.6.1.2 * 1.3e-22 31.4 %
:RPS:PFM   44->123 PF00116 * COX2 2e-09 31.2 %
:HMM:PFM   44->124 PF00116 * COX2 9.9e-22 33.3 81/120  
:HMM:PFM   6->24 PF10518 * TAT_signal 0.00023 36.8 19/26  
:BLT:SWISS 45->123 COX2_THETH 2e-12 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07485.1 GT:GENE ABF07485.1 GT:PRODUCT cytochrome c oxidase, subunit II GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 646427..646801 GB:FROM 646427 GB:TO 646801 GB:DIRECTION + GB:PRODUCT cytochrome c oxidase, subunit II GB:PROTEIN_ID ABF07485.1 GB:DB_XREF GI:93353396 InterPro:IPR001505 InterPro:IPR002429 LENGTH 124 SQ:AASEQ MNTANASRRTLLGWMLAAAVVPVVSVVSRSDAAAPRVIPMRARRFVFIPDRVKLKAGETVVLSITAEDVVMGFSAPDFDVRADLPPGQAIKVTLTAGKPGSYGFLCDIFCGSGHENMSGLIEVT GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 45->123|COX2_THETH|2e-12|34.2|79/135| SEG 17->37|aaavvpvvsvvsrsdaaaprv| BL:PDB:NREP 1 BL:PDB:REP 45->123|2qpeB|7e-13|34.2|79/166| RP:PDB:NREP 1 RP:PDB:REP 38->124|3dtuB|5e-17|23.0|87/259| RP:PFM:NREP 1 RP:PFM:REP 44->123|PF00116|2e-09|31.2|80/119|COX2| HM:PFM:NREP 2 HM:PFM:REP 44->124|PF00116|9.9e-22|33.3|81/120|COX2| HM:PFM:REP 6->24|PF10518|0.00023|36.8|19/26|TAT_signal| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| RP:SCP:NREP 1 RP:SCP:REP 38->123|1ehkB1|9e-14|32.6|86/128|b.6.1.2| HM:SCP:REP 21->125|2cuaB_|1.3e-22|31.4|105/135|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN ------------------------1--1--1------------------------------------- -1----------------------------------------------------------------------------------------------------------2---------------------------11111----1----------------------------------------11----1-------------------------112--11------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---1111111----1-1----1----------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 70.2 SQ:SECSTR #####################################HTTccGTTTcccccEEEETTcEEEEEEEEccccEEEEEGGGTEEEEEccTccEEEEEEccccEEEEEcccccccTTGGGccEEEEEE DISOP:02AL 1-6,8-8| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHEEEcccccccEEEccccEEEEEEccEEEEcccccEEEEEEEccEEEEEEEHHcccEEEEccccEEEEEEEEcccEEEEEEEHHHccccccccEEEEEEc //