[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07503.1
DDBJ      :             protein of unknown function DUF1316
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.373.1d.4.1
:144 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  20->53 1g8tA  d.4.1.2 * 5e-04 35.3 %
:RPS:SCOP  34->118 2ia7A1  d.373.1.1 * 2e-16 21.2 %
:RPS:PFM   34->102 PF04965 * GPW_gp25 2e-08 45.5 %
:HMM:PFM   33->116 PF04965 * GPW_gp25 1e-19 33.7 83/99  
:BLT:SWISS 34->97 VG25_BPT4 4e-05 26.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07503.1 GT:GENE ABF07503.1 GT:PRODUCT protein of unknown function DUF1316 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(676887..677321) GB:FROM 676887 GB:TO 677321 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1316 GB:PROTEIN_ID ABF07503.1 GB:DB_XREF GI:93353414 InterPro:IPR010745 LENGTH 144 SQ:AASEQ MTRGGPGLFEAVTGFFANGVAVDELDASTQTFLSVQDNIQRILNSRRGGLAHLPDYGLGDLSRIYRHLPASAHTLKREIETTLLRYEPRLKALDLEIEEPEPGMLLSFTMTCHLHQSGLVQFGTHFMPDGKTRLKLLRSAHDHD GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 34->97|VG25_BPT4|4e-05|26.6|64/100| RP:PFM:NREP 1 RP:PFM:REP 34->102|PF04965|2e-08|45.5|66/97|GPW_gp25| HM:PFM:NREP 1 HM:PFM:REP 33->116|PF04965|1e-19|33.7|83/99|GPW_gp25| RP:SCP:NREP 2 RP:SCP:REP 20->53|1g8tA|5e-04|35.3|34/241|d.4.1.2| RP:SCP:REP 34->118|2ia7A1|2e-16|21.2|85/111|d.373.1.1| OP:NHOMO 37 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---------------2--1-1---------------------------------------------------------------------------------------------------------------------------------------------1--------1-1111-----------1-1-------121--12--3--------------1----------1-111111211---------------------------------------------------------1----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,137-137,140-145| PSIPRED ccccccHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHcc //