[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07525.1
DDBJ      :             type II secretion system protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  188/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   164->281 3c1qA PDBj 3e-12 14.8 %
:HMM:PFM   176->304 PF00482 * GSPII_F 2.6e-21 35.2 122/124  
:HMM:PFM   111->158 PF00324 * AA_permease 0.00035 25.0 48/479  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07525.1 GT:GENE ABF07525.1 GT:PRODUCT type II secretion system protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(705624..706595) GB:FROM 705624 GB:TO 706595 GB:DIRECTION - GB:PRODUCT type II secretion system protein GB:PROTEIN_ID ABF07525.1 GB:DB_XREF GI:93353436 InterPro:IPR001992 LENGTH 323 SQ:AASEQ MQDIMQGFRADQLIVLALVFVAAFGTVLGVLYVFSPDRMRGRMEQIASETGTVPGNAGQQQAWVEKLVKWAQPVSRLSLPKEGWENSQLRVRFMNAGWRDASAAPLYFAAKTLLAVALPMIGLIATSSVPAFQEQSTTFAVLAVLAAIGYYIPNIVLSRKVTARQRTVFEEFPDVIDLLTVCVEAGLGLDAALMRVADELALRCPVLADELQLMLLELRSGFSKEKALSNLSLRTGVEDVDKFASMLIQADRFGTSLGESLRVLSDMLRTKRRMRAEEQAAKIALKLLFPLIFTIFPTLLLVLLGPAFIQIYRVLLPTMTGTN GT:EXON 1|1-323:0| TM:NTM 5 TM:REGION 13->35| TM:REGION 106->128| TM:REGION 137->158| TM:REGION 171->193| TM:REGION 290->312| SEG 207->218|ladelqlmllel| RP:PDB:NREP 1 RP:PDB:REP 164->281|3c1qA|3e-12|14.8|108/111| HM:PFM:NREP 2 HM:PFM:REP 176->304|PF00482|2.6e-21|35.2|122/124|GSPII_F| HM:PFM:REP 111->158|PF00324|0.00035|25.0|48/479|AA_permease| OP:NHOMO 259 OP:NHOMOORG 189 OP:PATTERN -------------------------------------------------------------------- 1-2----1--------------------------------------------132-1-11--1-----------------11-------------------------------------------11----121--11123---11--------------------------------------------1----------------------------------------1-----------------------------------------------------------------------------------------------------------------------1------111--1-----------31112------121211111111----------1-111113112321111121311222--12111-1111111--------111--1--------------------------------1222-----13222231122211213333233212232--221----11-1111-1---1------------11--1---11-1-1-111-2-1----1111111-11-------------------------1111-----1---1------1----1-11-11----------------1------------------------------------11----------------------------------------------------------1-----11--------------------1111----------111---------1-222-----21222------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 33.7 SQ:SECSTR ###################################################################################################################################################################cccccHHHHHHHHHHHHHHHHTT#cHHHHHHHHHHTcc###cHHHHHHHHHHHHHHTTccHHHHHTTcTTTc######cHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHTTcH######################################### DISOP:02AL 1-1,4-5,39-67,74-91,278-278,322-324| PSIPRED ccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //