[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07529.1
DDBJ      :             TadE-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->57 PF07811 * TadE 2e-05 46.5 %
:HMM:PFM   15->57 PF07811 * TadE 3.2e-12 39.5 43/43  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07529.1 GT:GENE ABF07529.1 GT:PRODUCT TadE-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(710354..710812) GB:FROM 710354 GB:TO 710812 GB:DIRECTION - GB:PRODUCT TadE-like protein GB:PROTEIN_ID ABF07529.1 GB:DB_XREF GI:93353440 InterPro:IPR012495 LENGTH 152 SQ:AASEQ MKHRAHPLRFARQRGLAAVEFALIAGMFFTLLIGIMEFSRVLFYWNTAAEVTRMAARSAVVCDSGASIIKTRMENMLPLLQDSNISVAYSPTGCDSDPATARSTCQTVTVSVSNVTIATMIPVMRLRIGMPPFTTTMTRESMQTSTGGSVCS GT:EXON 1|1-152:0| TM:NTM 1 TM:REGION 16->38| RP:PFM:NREP 1 RP:PFM:REP 15->57|PF07811|2e-05|46.5|43/43|TadE| HM:PFM:NREP 1 HM:PFM:REP 15->57|PF07811|3.2e-12|39.5|43/43|TadE| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111---------1111-111-1111---1---------11-------------------11-------------------------------------------------------------------------------1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,146-153| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEcccccEEEEEHHHccccccccccc //