[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07530.1
DDBJ      :             TadE-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->59 PF07811 * TadE 8e-08 51.2 %
:HMM:PFM   17->59 PF07811 * TadE 8.1e-15 41.9 43/43  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07530.1 GT:GENE ABF07530.1 GT:PRODUCT TadE-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(710809..711339) GB:FROM 710809 GB:TO 711339 GB:DIRECTION - GB:PRODUCT TadE-like protein GB:PROTEIN_ID ABF07530.1 GB:DB_XREF GI:93353441 InterPro:IPR012495 LENGTH 176 SQ:AASEQ MKRLTNAHRQSRTRQRGVAAVEFGIMLVPMLLMACGVAEFGRAIYQYDTLTKATRSAARYLSQYSPDDVAYPTAATKCLAAYGNTGCSGQPLAPGLTTAMVIICDRVDSSGCPGATQTFSNVATYDSTGGGSGTQAGTVNLIAVRISGYTYTPLQSFINVSGLTFGDITTVMRQVL GT:EXON 1|1-176:0| TM:NTM 1 TM:REGION 19->41| SEG 127->134|stgggsgt| RP:PFM:NREP 1 RP:PFM:REP 17->59|PF07811|8e-08|51.2|43/43|TadE| HM:PFM:NREP 1 HM:PFM:REP 17->59|PF07811|8.1e-15|41.9|43/43|TadE| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111---------1111-111-1111---1---------11------1------------11-----------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccEEEEcccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEEEEEEcccccHHHccccccccHHHHEEEHHHc //