[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07543.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:408 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   105->324 PF09594 * DUF2029 1e-08 35.6 %
:HMM:PFM   103->326 PF09594 * DUF2029 7.9e-39 34.8 224/241  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07543.1 GT:GENE ABF07543.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(723245..724471) GB:FROM 723245 GB:TO 724471 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID ABF07543.1 GB:DB_XREF GI:93353454 LENGTH 408 SQ:AASEQ MPAATDTPKTASLDSATPARWLTPGRICLYAATLLVLECVVVAAWWYGHSVIANPSVPRLGWDFVVYWCASGLAQMHGAVAAYDWELLRVAKTPLLPNTFGPFAYPPTFLLMIYPLAALPFSMALVLFALTGIALYLGYLRAVVGNLHRYWIVPALAFPGVWTTLISGQNSLYTLAAAGGALWLMRRHPVAAGACIALLCVKPQLGVLFPLMLLCERRWTAMAAAAGCSALFVGLTVMAFGVDIYPAFLHSLAMFRETVAVNIDTLRGAPTVFGVLYVAGASIPLANGVHAAVALCAIATCVWVWCTKPRLALSASALVVGTLLTQPYLIYYDLAWLAIPVALLCVDMIRFGSRGWERLLLIVTWFAPMQGLSPFFIDHVPQLAPLVLVCLLGLIVLRHQAARSAAQS GT:EXON 1|1-408:0| TM:NTM 9 TM:REGION 26->48| TM:REGION 113->135| TM:REGION 148->170| TM:REGION 192->214| TM:REGION 227->249| TM:REGION 277->299| TM:REGION 321->343| TM:REGION 353->375| TM:REGION 380->402| SEG 380->397|vpqlaplvlvcllglivl| RP:PFM:NREP 1 RP:PFM:REP 105->324|PF09594|1e-08|35.6|219/236|DUF2029| HM:PFM:NREP 1 HM:PFM:REP 103->326|PF09594|7.9e-39|34.8|224/241|DUF2029| OP:NHOMO 66 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------14---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22--1--2----------------1---------1-----------------------------------11---------------------------------------------444443---------2222-232-1214--13------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14,402-409| PSIPRED cccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccHHHHccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcc //