[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07548.1
DDBJ      :             putative integral membrane sensor protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  86/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:262 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   134->177 PF03707 * MHYT 2e-04 45.5 %
:HMM:PFM   64->107 PF03707 * MHYT 3.7e-14 36.4 44/62  
:HMM:PFM   128->186 PF03707 * MHYT 1.8e-15 39.0 59/62  
:HMM:PFM   191->235 PF03707 * MHYT 2.7e-07 41.0 39/62  
:BLT:SWISS 16->203 Y1727_PSEAE 4e-18 37.1 %
:TM
:REPEAT 2|70->111|134->175
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07548.1 GT:GENE ABF07548.1 GT:PRODUCT putative integral membrane sensor protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 730033..730821 GB:FROM 730033 GB:TO 730821 GB:DIRECTION + GB:PRODUCT putative integral membrane sensor protein GB:PROTEIN_ID ABF07548.1 GB:DB_XREF GI:93353459 InterPro:IPR005330 LENGTH 262 SQ:AASEQ MFSGFAAVPGAVVPYSYNWLMVGLSFLISACGAYVALRWCRGIRKPNGRLDVDRLMCASVALGGGAVWAMHFIGMVAYQTPTHMEFSLLVTLASLLAVMVFAAAGLAKASSPTGNPLSNTIKGGVLTGTGVVVMHYTGMAAIHTNSVFEWDLFIVALSALIAIVVSAVGLWLATNVKTVAQQIGAALVMAVAVCGMHYTGMTAGTMICTGRTYSPTLLALEGDNMGYAVFALTAVVLIFILVIEATRSGSQSVSVASASGRH GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 16->203|Y1727_PSEAE|4e-18|37.1|186/685| TM:NTM 6 TM:REGION 20->42| TM:REGION 54->76| TM:REGION 86->108| TM:REGION 147->169| TM:REGION 174->195| TM:REGION 229->251| NREPEAT 1 REPEAT 2|70->111|134->175| SEG 87->98|sllvtlasllav| SEG 123->133|ggvltgtgvvv| SEG 247->261|rsgsqsvsvasasgr| RP:PFM:NREP 1 RP:PFM:REP 134->177|PF03707|2e-04|45.5|44/59|MHYT| HM:PFM:NREP 3 HM:PFM:REP 64->107|PF03707|3.7e-14|36.4|44/62|MHYT| HM:PFM:REP 128->186|PF03707|1.8e-15|39.0|59/62|MHYT| HM:PFM:REP 191->235|PF03707|2.7e-07|41.0|39/62|MHYT| OP:NHOMO 105 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- 1-----------------------------------11-----4-----------------------2------------------------------------------------------------------------------------------------1----------------------------------------------11-----------1------1------------------------------------------------------------------------------------------------------------------------------------------------211----------1--------------------1----11--1---------111-----1--------------------11----------------------------------------2221-111-11-2221--1122211-1--1111--1---1-------1------------------1------------------------------------------------------------------11---1-------11---------------------------1--2---------------------------------------1-11111111-1111--------------------------------------------------------------------1111212111111----------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 250-263| PSIPRED ccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEccccHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHHccccccEEEEccccccc //