[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07556.1
DDBJ      :             response regulator receiver domain protein (CheY-like)
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  861/915 : Eukaryota  101/199 : Viruses  1/175   --->[See Alignment]
c.23.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->120 1zesC PDBj 2e-19 37.1 %
:RPS:PDB   5->120 3cnbC PDBj 1e-23 25.0 %
:RPS:SCOP  5->120 1a0oA  c.23.1.1 * 2e-26 31.0 %
:HMM:SCOP  1->122 1s8nA_ c.23.1.1 * 1.1e-35 35.3 %
:RPS:PFM   6->117 PF00072 * Response_reg 3e-18 40.9 %
:HMM:PFM   6->117 PF00072 * Response_reg 2.4e-30 34.5 110/112  
:BLT:SWISS 3->120 PILH_PSEAE 2e-28 49.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07556.1 GT:GENE ABF07556.1 GT:PRODUCT response regulator receiver domain protein (CheY-like) GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 736776..737144 GB:FROM 736776 GB:TO 737144 GB:DIRECTION + GB:PRODUCT response regulator receiver domain protein (CheY-like) GB:PROTEIN_ID ABF07556.1 GB:DB_XREF GI:93353467 InterPro:IPR001789 LENGTH 122 SQ:AASEQ MTISKILIVDDSPTEALFMSDLLGKKGFKVSVAGNSDQAMARLEADAFDLILMDVVMPGQNGYQATRAIKRDDRFKDIPVIMCTSKGLETDRIWGMRQGASDYVVKPVDSEELLSKIAALAN GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 3->120|PILH_PSEAE|2e-28|49.2|118/121| BL:PDB:NREP 1 BL:PDB:REP 5->120|1zesC|2e-19|37.1|116/120| RP:PDB:NREP 1 RP:PDB:REP 5->120|3cnbC|1e-23|25.0|116/123| RP:PFM:NREP 1 RP:PFM:REP 6->117|PF00072|3e-18|40.9|110/111|Response_reg| HM:PFM:NREP 1 HM:PFM:REP 6->117|PF00072|2.4e-30|34.5|110/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 5->120|1a0oA|2e-26|31.0|116/128|c.23.1.1| HM:SCP:REP 1->122|1s8nA_|1.1e-35|35.3|119/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 11289 OP:NHOMOORG 988 OP:PATTERN -----------------------21----223--12--2222155-5N2973A-1-1-11-------- 6PQ3B25455543465555-5B1146444445A88957A6776C64444443967356119CC4D6AGEC6233334446HA8-4567LLZP-E11---94N5DAY9aBN1------11111111212A76453C7WXXXT737a5xbqoccCNLHH545687VVKDsu*M464554554544G973345197EQQQQQOOOGRNTRRLHJAA89ORW9ADR8GC788887ha6666666566666665555675747754434665587655463232888555735554555554555344444444444443333333367PGFhIIIJJKMNLJCROO8796OGH64DILD6ZVQGA966979798237LNIIKKF44434DBQUUAADGNCII88788888779-IIPJFNKLDHC-LDDJIFKONKKJCGCBBDADF9GECEA777777776AA57hJJ1111111111111222212112111111123AA347CC8DOPQRRMMEEEDMNSXGFGHAFPPQIOMO11CHGeCJEFRENTJAFIUDHBDUB111111198BFV*HnmWFDvMC*iONV3saltbcaJQVPcWspKO654534444453222223229876867UN7QSVIARPERGMMIFJIPMMGNKJJHNZ--58DFC------DDED8A99AAA9AAB99-ABA999999AA99999999HGH8A7769999999989989899D7889999519AAAAAAA9BAA--3C222223433AHrAX323433222223113EDCCFAB8A9MPZXcYeehjbedieQZWZ221212212DGIITHIIIILKNRROPOLPLLKMN88781-*-EE6667222122123---------------------------5C356555452N2 ----681-------A331-11121111111111----2221221221-32322411111-1--12-1--1111-111111-11111----113111212-443466-12-------------------------------------------------4----3-1-------3-1452-1112-F8EG18B217---1 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEcccHHHHHHHHHHHHHHTcEEEEEccHHHHHHHHHHTcccEEEEETTcTTccHHHHHHHHHTcTTTTTcEEEEEEccccHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHH DISOP:02AL 1-1| PSIPRED ccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHcc //